Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G062154-GRMZM2G068586
Species:maize
Duplication type:WGD
Function (paralog1):tubby protein
Function (paralog2):hypothetical protein LOC100193706

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:1.0062423608163
Log2 mRNA fold difference:1.5491249020452
Log2 TE fold difference:-0.54770311616984
Sequences
Protein sequence

MPRHTAPAAPPSERGEMDEVVEADPDTEAEDQEERWATLLPELLSDVLLRVEASGAEQWP
ARKDIVSFACVCRWWRKAAVSVVRPPAESAKITFPSSLKQPGPRENPMQCFIMRNKNSTF
YLYLGFTSSPVYKGKFLMAARRLRRGPHTEYIISLDAEDLSQGSNSYMGKLRSDFWGTNF
KIYDSKPPYDGAKASSSRSSRRFGSRRISPQVSSGNYEVGQVSYKYNLLKSRGPRRMNCT
LECPSAQETWENSLKTKFRRPLGPTTLRNKAPRWHEQLQCWCLNFHGRVTVASVKNFQLV
TAAGPSDPTSNVDEETVLLQFGKVDDDIFTMDYRQPLSAFQAFAISLSSFGNKLACE*

MPRDGAQAAPPPERGEMDEVVEADPDTEAEDQEERWARLLPELLSDVVRRVEASGGERWP
ARKDVVSCACVCRRWREAAVSVVRPPAESGKITFPSSLKQPGPRERPMQCFIKRNKNNST
FYLYLGFTSSPVDKGKFLMAARRFRRGPHTEYIISLDAEDLSQGSNAYMGKLRSDFWGTN
FKIYDSKPPYDGAKASSSRSSRRFGSRRISPQVSAGNYEVGQVSYKYNLLKSRGPRRMYC
TLECPSAQETWENSLKTKFRRPLGPTTLRNKAPRWHEHLQCWCLNFHGRVTVASVKNFQL
VAAADPSEPTTNVDDETVLLQFGKVDSDMFTMDYRQPLSAFQAFAISLSSFGTKLACE*

Other information
Ka divergence:-0.563394KaKs divergence:0.00392003
GC content 1 (%):53GC content 2 (%):55GC content divergence:0.019
Length 1 (bp):1074Length 2 (bp):1077Length divergence:0.001
MFE 1 (kcal):-395.99MFE 2 (kcal):-404.53MFE divergence0.011