Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G062289-GRMZM2G139805
Species:maize
Duplication type:WGD
Function (paralog1):brain protein 44-like
Function (paralog2):brain protein 44-like protein

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-2.8908933160779
Log2 mRNA fold difference:-4.206447894282
Log2 TE fold difference:1.3399803558852
Sequences
Protein sequence

MATALKSFLNSPVGPKTTHFWGPVANWGFVIAGLVDMNKPPEMISGNMTAAMCVYSGLFM
RFAWMVQPRNYLLLACHASNESVQLYQLSRWARSQGYLEKKEPEAKQ*

MATALKSFLNSPVGPKTTHFWGPVANWGFVVAGLVDMNKPPEMISGNMTAAMCVYSGLFM
RFAWMVQPRNYLLLACHASNESVQLYQLSRWARAQGYLEKKEPETQQ*

www.000webhost.com

Other information
Ka divergence:-0.306667KaKs divergence:-0.548387
GC content 1 (%):52GC content 2 (%):54GC content divergence:0.019
Length 1 (bp):324Length 2 (bp):324Length divergence:0
MFE 1 (kcal):-106.7MFE 2 (kcal):-116.8MFE divergence0.045