Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G062373-GRMZM2G106690
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100192770
Function (paralog2):USP family protein

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.44072571083173
Log2 mRNA fold difference:-0.42689680598034
Log2 TE fold difference:-0.015602119872047
Sequences
Protein sequence

MAAKLSTSADAPASVRLSAAAQAAAIQPSSPRFFFSSLAGTNPASPHRRIAIAVDLSDES
AFAVKWAVQNYLRPGDAVVLLHVRPTSVLYGADWGSIPVSVADEADAAEDAAAAAEGGPS
EEELQKKREEEYDAFTSTKAQDLAQPLVDAQIPFKIHVVKDHDMKERLCLEAERLGLSAM
IMGSRGFGASRKGGKGRLGSVSDYCVHHCVCPVVVVRYPDDAADASGDASGATDELHTVP
EDEPVYHDAPEVQKGLPLFFF*

MATNPSNGAGADVPAAPAAVRLSVAAQAAAIQPSSPRFFFSSLAGTNPASPHRRIAIAVD
LSDESAFAVKWAVQNYLRPGDAVVLLHVRPTSVLYGADWGSIPVSVADEDDAAEDAAAAA
EGGPSEEELQKKREEDYDAFTSTKAQDLAQPLVDAQIPFKIHVVKDHDMKERLCLEAERL
GLSAMIMGSRGFGASRKGSKGRLGSVSDYCVHHCVCPVVVVRYPDDAADAGGDASGVTDE
LHTVPEDEPVYHDAPEVQKEN*

Other information
Ka divergence:-0.170169KaKs divergence:-0.152783
GC content 1 (%):64GC content 2 (%):65GC content divergence:0.008
Length 1 (bp):786Length 2 (bp):786Length divergence:0
MFE 1 (kcal):-345.2MFE 2 (kcal):-338.08MFE divergence-0.01