Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G062377-GRMZM2G115612
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100279941
Function (paralog2):hypothetical protein LOC100279711

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.77278010714474
Log2 mRNA fold difference:1.3175359325238
Log2 TE fold difference:-2.5790347540431
Sequences
Protein sequence

MEAAAAVVGFGAGAGLTRWQAAALSAVAGWVWAASFYDLTRRARALVQPWVTRRVHAETA
AILRFQRLEHKLLDNIFSVLSCVVSVPFYTGFLPLLFWSGHGRLARQMTLLMAFCDYLGN
SVKDIVSAARPCSPPVRRVTATEDEKENAMEYGLPSSHALNTVCLTGYLLHYILTFGEHG
SVTVAAGLSLAFLLVMLVGIARIYLGMHSLTDVVAGIGFGVVILAFWLAVHDRVDAFVVS
GENVATFWAGLSLLLCFAYPKPEFPTPSFEYHTAFNGVAFGIVYGIQQTYFHFHTPDAPV
VFSAELPLLTFAGRVLVGIPTILAVKFCSKALSKWLLPVVCSTLGIPTVSSCYVPALRAD
SGSGSGKNRQGPGHLQRLLFSHFPRKAYDVDTGIRFVQYASLAWSVVDLVPAMFAHLNL*

MEAAAASAAAVGGSGAGLTRWQAAALAALAGWVWAASFYDLTRRARALVQPWVTRRVHAE
TPAILRFQKLEHKLLDNFFSVLSCVVSVPFYTGFLPLLFWSGHGRLARQMTLLMAFCDYL
GNSVKDMVSAPRPCSPPIRRVTATEDEKENAMEYGLPSSHALNTVCLTGYLLHYVLTYGE
HGSLTVAAGLSLALLLVMLVGIARIYLGMHSLTDVVAGIGFGIVILAFWLAVHDHVDAFV
VSGQNVATFWAGLALLMCFAYPKPEFPTPSFEFHTAFNGVAFGIVYGIQQTYFHFHAPDA
PIVFSAELPFLAFAGRVLVGIPTILAVKSCSKALSRWLLPVMCSTLGIPIVSSCYVPALK
IDGGSSKSRQAAGGHLQRLLSHFPQKAYDVDTGIRFVQYASLAWSVVDLVPAIFAHLDL*

Other information
Ka divergence:0.390397KaKs divergence:0.454397
GC content 1 (%):60GC content 2 (%):60GC content divergence:0
Length 1 (bp):1260Length 2 (bp):1260Length divergence:0
MFE 1 (kcal):-532.4MFE 2 (kcal):-514.84MFE divergence-0.017