Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G062394-GRMZM2G108355
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100381284
Function (paralog2):PP2Ac-2 - Phosphatase 2A isoform 2 belonging to family 2

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.36638418981269
Log2 mRNA fold difference:0.40572766085405
Log2 TE fold difference:-0.052706357078944
Sequences
Protein sequence

MSSPHGGLDDQIERLMQCKPLAEPEVRALCEKAKEILMEESNVQPVKSPVTICGDIHGQF
HDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLVSLKVRYPQRITILRGNHESRQ
ITQVYGFYDECLRKYGNANVWKTFTDLFDYFPLTALVESEIFCLHGGLSPSIETLDNIRN
FDRVQEVPHEGPMCDLLWSDPDDRCGWGISPRGAGYTFGQDISEQFNHTNSLRLIARAHQ
LVMEGFNWAHEQKVVTIFSAPNYCYRCGNMASILEVDDCREHTFIQFEPAPRRGEPDVTR
RTPDYFL*

MSSPHGGLDDQIERLMQCKPLAEPEVRALCEKAKEILMEESNVQPVKSPVTICGDIHGQF
HDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPQRITILRGNHESRQ
ITQVYGFYDECLRKYGNANVWKTFTDLFDYFPLTALVESEIFCLHGGLSPSIETLDNIRN
FDRVQEVPHEGPMCDLLWSDPDDRCGWGISPRGAGYTFGQDISEQFNHTNSLRLIARAHQ
LVMEGFNWAHEQKVVTIFSAPNYCYRCGNMASILEVDDCREHTFIQFEPAPRRGEPDVTR
RTPDYFL*

Other information
Ka divergence:-1KaKs divergence:-0.979381
GC content 1 (%):46GC content 2 (%):45GC content divergence:-0.011
Length 1 (bp):924Length 2 (bp):924Length divergence:0
MFE 1 (kcal):-298MFE 2 (kcal):-294.27MFE divergence-0.006