Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G062412-GRMZM2G164649
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100191835
Function (paralog2):ATPase

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:1.017185372793
Log2 mRNA fold difference:-0.18526596893068
Log2 TE fold difference:1.2038190390136
Sequences
Protein sequence

MRSVVRSLRQLRRFTQHHAEGHSQATRLFGQQNALIMCGSTSGSLSTLRCNGEISRFASP
GVELMRSMFSTVVTDPIKDIGRGGPMVEYERRIASGELVDGDSFQVDTIQQLQRLYEELI
ENEEDCQLDRYKSSEKSGRSRWLWSRLITQPSTYAPIKGLYLYGGVGTGKTMLMDLFYEQ
LPFNWRKKRIHFHDFMLNVHSRLQMHKGVSDPLDVVAAEISDEAIILCLDEFMVTDVADA
MILNRLFRQLFSKGVILVSTSNRAPDKLYEGGLQRDLFLPFIDTLKERCIVHAIGSAVDY
RQLGSAEQGFYFVGKHYSTLLKQKLQSLIGDEKPSPQTVEVIMGRKLQVPLGANGCAYFP
FEDLCDKPLGAADYFGLFKKFHTLALDGIPKLGSSNRTAAYRFVTLIDVMYENKARLLCT
AEAGPVGLFENIVTVAEARKVSPRSSRSQKSDDTDLCVDNELGFAKDRTISRLTEINSRE
YLEDFEMRLRQQQQLPLQGLDKRW*

MRSVVRSLRQLRRFIQHYAEGNSQATRLFGLQNALIMCGSTPRSLSMLRRNGEISRFASP
GMELMRSMFSNVAAGSIKDIGRGGPMVEYERRIASGDLVDGDSFQVDTIQQLQGLYEELI
ENGEDCQLDRYKSSEKSGRSRWLWSRLITQPSSFAPVKGLYLYGGVGTGKTMLMDLFYEQ
LPSNWRKKRIHFHDFMLNVHSRLQMHKGVSDPLDVVAAEISDEAIILCLDEFMVTDVADA
MILNRLFRQLFSKGIILVSTSNRAPDKLYEGGLQRDLFLPFIDTLKERCIVHPIGSAVDY
RQLGSAEQGFYFVGKHYSTLLKQKLQSLIGDEEPSPQTVEVIMGRKLQVSLGANGCAYFP
FEDLCDRPLGAADYFGLFKKFHTLALDGVPKFGSSNRTAAYRFVTLIDVMYENKARLLCT
AEAGPVELFENIMTLAEAQKVSPRSSRSQKSDDPDLCVDNELGFAKDRTISRLTEINSRE
YLEDFEMRLGQQQLLPLQALDNGGDVTSIISRRLLGLI*

Other information
Ka divergence:0.0734159KaKs divergence:0.23729
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):1515Length 2 (bp):1557Length divergence:0.014
MFE 1 (kcal):-456.9MFE 2 (kcal):-480.7MFE divergence0.025