Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G062420-GRMZM2G106376
Species:maize
Duplication type:WGD
Function (paralog1):LOC100283069
Function (paralog2):hypothetical protein LOC100193984

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.55197190325175
Log2 mRNA fold difference:-2.047946824486
Log2 TE fold difference:1.5034736731683
Sequences
Protein sequence

MDTDTATAMGALEEAHLAAAACACEEEEESDYIGFLAGEAAAGDAVEPAVRALLLGLGED
DRREGLLRTPKRVAKAFRDGTRGYRQKVKDIVQGALFPEVGVDKRTGSAGGTGGQVVVRD
IELFSYCESCLLPFSIQCHVGYVPSGGRVVGLSKLSRVSDVFAKRLQNPQRLANEICGAL
HASIQPAGVAVALQCWHIPLPENLECKTLEGWIRTSHSSRSGVFEGESSTFWSDFLALVK
LRGIDVEAKDRTVSIPWCPLRSHEVPLSNGLCKKNSTNGMVSAVTSMLLSLGEDPLRKEL
LGTPQRYVQWLMKFKACNLLDVKLNGFTLSNVSLYERTGGGTTDHGAIRSELHLPFCAQC
EHHLLPFYGVVHIGYFGNGSGEGIDRSHFQALVHFYGCKLQVQERMTRQIAEAVYSVSHN
GAMVVVEANHICMISRGIEKIRSNTATIAVLGQFLADPSAKACFLQNVLDSVGSAV*

MGALEGAHLAAVACACDDDEEQSDCIPLLAGDAATAADAMEPAVRALLLGLGEDDRREGL
RRTPKRVSKAFRDGTRGYRQKVKDIVRGALFPEVGVDKRTGSAGGTGGQVVVRDIELFSY
CESCLLPFSIQCHVGYVPSGGRVVGLSKLSRVSDVFAKRLQNPQRLANEVCGALHASIQP
AGVAVALQCWHIPLPENLECKTLQGWIRTSRSCRSGLFEGESSTLWSDFLALVKLRGIDM
EAGTGDRCVSVPWCPLRSREVPLSNGLCKKSSTNGMVSAVASMLLSLGEDPLRKELLGTP
QRYVQWLMKFRARNLLDVKLNGFTLGNASLHERPGGGTADHGHGSIRTELHLPFCAQCEH
HLLPFYGVVHIGYLDKGSGEGIIDRSHFQALVRFYGCKLQVQERMTRQIAEAVHSVSRNG
AMVVVEASHMCMISRGVEKIRSNTATVAVLGHFLTDPSAKARFLQNVLRTAGSAV*

Other information
Ka divergence:0.293068KaKs divergence:0.0793909
GC content 1 (%):51GC content 2 (%):55GC content divergence:0.038
Length 1 (bp):1431Length 2 (bp):1428Length divergence:-0.001
MFE 1 (kcal):-527.44MFE 2 (kcal):-564.5MFE divergence0.034