Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G062718-GRMZM2G409312
Species:maize
Duplication type:TD
Function (paralog1):hypothetical protein LOC100272813
Function (paralog2):LOC100283095

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.38457832442031
Log2 mRNA fold difference:0.44592187190023
Log2 TE fold difference:-0.3300022879663
Sequences
Protein sequence

MAPGSSSSRKAKALKASYRLVADNFLAVLAMVSVVAVLFAAWPISIEDLACRLHAVRPLH
VLTAAILTAALAKLRRMSRPSDVYLVEYGCFWPKPCFRAPFATCLEHVRLLPYLVNEDDI
SWGWRLLQRSGIGEETCVPYAYHYLPPDRSFRASLDETELVIFSAVDDVFARTTAVTPAD
IGVVIVNCSIFTPTPVFTDMIVNRYKLRADVRSVNLSGMGCSAALISIGLARNMLQVAPP
GTHALIVSTEILSSQYYVGMDRSMLLPNCLFRMGAAAMIMSNTAARGARFRLARVVRTVA
SARDAAYRCVFQVEDEESNTGIRLSKDLVPTAAQTLKSNIVAFGPLVLPASEKLLVALSI
LRRRLVQSSRGRVYRPDFRTAFEHFCIHAGGRGVIDEVQRGLGLSDEDVEASRMTLHRFG
NTSSSSVVYELAYIEAKGSMRKGDRVWMISFGAGFDCSSVAWECIEPAADAAGPWADCIH
RYPVQLPKLMEALD*

MAKLLKPWYAAFVNRFLAMVAVASIVAAALRRAWPAFSMDDVVGSLGAARPVHVLMAVIL
AAGVAKLRRLRRPRDVYLVEYGCFRPRPCFRAPFATCLEHVHLLPYLVDDESVSFAIRLL
ERSGLGDETCLPYSYHYMPPDRSLEAAREEAELVIFSAVDEVFARASVRPEEIDVLIVNC
SIFTPTPVFADMVVNRYGLRADVQCLNLSGMGCGAGLVSIGLAKNLLQVAPPGTRVLTVS
TEILSSQYYVGSERAMLLPNCLFRMGAAATILSNSPERARFRLGRLVRTMTAARDADYRC
IFQEEDGEGILGVRLSKDLTTTAGHALKRNIAAFGPLVLPVSEQLLVAMSLLKRKFMSGR
RARVRLYRPDFRKAFEHFCIHAGGRAVIDEVQRGLGLSDEDVEASRMTLHRFGNTSSSLV
LYELAYIEAKARMRAGDRVWMISFGAGFECSCVALECVKPPADAGGPWADCIDRYPVHLP
EVAKDNI*

Other information
Ka divergence:-0.151694KaKs divergence:-0.389508
GC content 1 (%):67GC content 2 (%):68GC content divergence:0.007
Length 1 (bp):1485Length 2 (bp):1464Length divergence:-0.007
MFE 1 (kcal):-734.17MFE 2 (kcal):-747.2MFE divergence0.009