Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G062885-GRMZM2G155370
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):LOC100281423

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.010344600572591
Log2 mRNA fold difference:0.83132122707729
Log2 TE fold difference:-0.84850187507284
Sequences
Protein sequence

MSSSCMPTGLRLDLDMVKAAASPGAHSSPLRPVHSSPSSTLSEASNASSSATSVSLKRAR
APRKRPNQAYNEAAALLASIHPSVFPVKKSPKTAPPRPPSSRQLSGLAAALDASSSDLLP
PLPVLADSAFLLRDIPAPSPLPQPQSPSAAKNCSSPAPVSSAFRDFRDPAPSPASPDTVD
VNELGEIDFDDDGFDAESILDVEEAAAAAEGLDGIMGSLTVESNSTAATTSDDSILSSSG
IHPYLRSLMVVGLAGRFELGLGSRHGARPNLNRALKRRDDDGAWWMWPAVPVKDLTVAPP
TPPASNAAVSQPQPAAAPEKNKSKKKKVVKVEKVMMGAKGKEELLPSAKCKEEEADGDGD
AESAPVKAPKTGLGLKLDADEVLKAWSDRGSMFAEGSAPESPTSVAEARAKLSDMDLFPE
NEAGAGAGGVREASVLRYKEKRRTRLFSKKIRYQVRKVNADCRPRMKGRFVRSPSLLRQA
LEEES*

MSSSCIPTGLRLDLDMVKAAASPVGAHSSPLRPAHYSSPSSTLSSEASNASSSSATSVSL
KRARAPRKRPNQAYNEAAALLASIHPSVFPVNKSPKTAPPRPPQLSVLAAALDASPDLLP
PLPVLADSAFLLRDQDTPSPKPRSPSGAKNCPSPAPVSSAFRDFRDPPSSASLDAVGADE
LGEIDFDDDGFNADSILDVGDAAAGGLDGIMGSLTVDVESGTAARSDDSILSSSGIHPYL
RRLMVVGLAGRFELGLGSQHGARPSLNRALKRRDDDGAWWMWPAVPVKDLTIAPPAPPAP
PAPNAAVPQAAAAAAPEKKKSKKKKVVKAMAKGNEELLPNAKCKEEEADASVDDAAANGD
GDSDSAPTNAPKAGLGLKLDADEVLKAWSDKGSMFAEGSGPELPTSAAEVRAKLADIDLF
PENGAGGGGVREASVLRYKEKRRTRLFSKKIRYQVRKVNADCRPRMKGRFVRSPSLLRQA
LEEET*

Other information
Ka divergence:0.31936KaKs divergence:0.296219
GC content 1 (%):69GC content 2 (%):68GC content divergence:-0.007
Length 1 (bp):1458Length 2 (bp):1458Length divergence:0
MFE 1 (kcal):-728.91MFE 2 (kcal):-722.7MFE divergence-0.004