Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G063322-GRMZM2G092535
Species:maize
Duplication type:WGD
Function (paralog1):snRNP core Sm protein Sm-X5-like protein
Function (paralog2):SnRNP core Sm protein Sm-X5-like protein

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:3.2347011928252
Log2 mRNA fold difference:0.97090420195107
Log2 TE fold difference:2.2622589675544
Sequences
Protein sequence

MLFFSYFKELVGKEVTVELKNDLAIRGTLHSVDQYLNIKLENTRVVDQDKYPHMLSVRNC
FIRGSVVRYVLLPQDGVDVDILHDATRREARGG*

MLFFSYFKELVGKEVTVELKNDLAIRGTLHSVDQYLNIKLENTRVVDQDKYPHMLSVRNC
FIRGSVVRYVLLPQDGVDIDILHDATRREARGG*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):61GC content 2 (%):59GC content divergence:-0.017
Length 1 (bp):282Length 2 (bp):282Length divergence:0
MFE 1 (kcal):-109.62MFE 2 (kcal):-106.4MFE divergence-0.015