Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G063340-GRMZM2G139900
Species:maize
Duplication type:WGD
Function (paralog1):ribosomal proteinS12 (homolog)
Function (paralog2):hypothetical protein LOC100193804

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.53363609072881
Log2 mRNA fold difference:-0.099883609075364
Log2 TE fold difference:-0.40199683920481
Sequences
Protein sequence

MAEQEAPVAVEAPTPVLGEPMDLMTALQLVMKKSSAHDGLVKGLREAAKAIEKHAAQLCV
LAEDCDQPDYVKLVKALCAEHNVHLVTVPAAKTLGEWAGLCKIDSEGKARKVVGCSCVVV
KDYGEESEGLNIVQEYVKSH*

MADQEAPVAVEAPTPVLGEPMDLMTALQLVMKKSSAHDGLVKGLREAAKAIEKHAAQLCV
LAEDCDQPDYVKLVKALCAEHNVHLVTVPAAKTLGEWAGLCKIDSEGKARKVVGCSCVVV
KDYGEESEGLNIVQEYVKSH*

Other information
Ka divergence:-1KaKs divergence:-0.990431
GC content 1 (%):56GC content 2 (%):53GC content divergence:-0.028
Length 1 (bp):423Length 2 (bp):423Length divergence:0
MFE 1 (kcal):-161.8MFE 2 (kcal):-150.5MFE divergence-0.036