Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G063617-GRMZM2G010991
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100192778
Function (paralog2):LOC100283364

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MARGVVSAKGGAVAGKKKGSVSFTIDCTKPVEDKIMEVASLEKFLQERIKVAGGKAGNLG
DSVTISREKTKVTVTSDGPFSKRYLKYLTKKYLKKHNVRDWLRVVAANKDRNVYELRYFN
IAENEGEEED*

MARGVVSAKGGTAAGKKKGSVAFTIDCTKPVEDKIMEIASLEKFLQERIKVAGGKAGNLG
ESVIISREKTKVTVTCDGPFSKRYLKYLTKKYLKKHKVRDWLRVIAANKDHSVYELRYFN
IAENEGEEED*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):59GC content 2 (%):58GC content divergence:-0.009
Length 1 (bp):393Length 2 (bp):393Length divergence:0
MFE 1 (kcal):-148.9MFE 2 (kcal):-154.7MFE divergence0.019