Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G063679-GRMZM2G026892
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100275668
Function (paralog2):hypothetical protein LOC100193214

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MRPLPPPLPLLLASWSVFNGRRERKRTERERGRTKPSASSPAVPSHIYSASACTFDLAES
SDLKLKGACEAFPCGSAMEVFGKSVIAEPSNVIFLSAILNTEGSNPSHKCDKRCQNENIF
GNMYRCKLTGTTHICDKNCNQRILYDNHNSLCRVSGQFFPLSPLEQQAVRGIRRKHEVDS
NEGCSFKRRRGAQLHPSPFERSYSAVSPIPSQVGDGMDLS*

MEVFGKSVIAEPSNVIFLSAILNTEGSNPSHKCDKRCQSERILGNMYRCKLTETTHICDK
NCNQRILYDNHNSLCRVSGQLFPLSPLEQQAVRGIRRKHEVDSSEGCCFKRRRGAQLHPS
PFERSYSAVYPIPSQVGDGMDMS*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):52GC content 2 (%):52GC content divergence:0
Length 1 (bp):663Length 2 (bp):432Length divergence:-0.211
MFE 1 (kcal):-238MFE 2 (kcal):-146.64MFE divergence-0.238