Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G063756-GRMZM2G167549
Species:maize
Duplication type:TD
Function (paralog1):Cytochrome P450 71C3 (EC 1.14.-.-)(Protein benzoxazineless 5)
Function (paralog2):Cytochrome P450 71C2 (EC 1.14.-.-)(Protein benzoxazineless 3)

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.9506222873805
Log2 mRNA fold difference:0.10333361709387
Log2 TE fold difference:-1.0534154204126
Sequences
Protein sequence

MALQAAYEYLQQAVGHGAWSSTQTLTLLLIAVPTVLLLLASLAKSTSSSGRGKPPLPPSP
PGTLPIVGHLHHIGPQTHISLQELVAKYGHNGFLFLRAGAVPTLIVSSPSAAEAVMRTHD
HIFASRPWSMASHILRYNTCDVAFSPLGEYWQQTRKLMNTHLLSNKKVYSFRHGREEEVC
LVVDNLREAAAKSPSTAVDMSEVLAAYTNDVVSRSVLGSTHRKKGRNTLFREMTMTNVDL
LVGFNLEYYIPRWPLTDLLFRLVCWKVTRHLKRWDALLEEVIHEHVEMRKLSGDKEKESD
DFIDIFLSRYEEYGFTMDNVKSLLMNVFEAAIETSYLVLESAMAELMNHRRVMKKLQAEV
RAYGAEKKLDMIREDDLSSLPYLKASMKEALRLHPPGPLLLPHYSTADCQIDGYHIPANT
RVLVNGWAIGRDPAVWEKPEEFMPERFMRDGWDKSNSYSGQDFRYLPFGSGRRICPGANF
ALATMEIMLANLMYHFDWEVPNEKEDGGGKVSMDETFGLMLRRNEPLYLVPRAV*

MALGAAYHHYLQLAGDHGTATHALLLGVLIFLVIRLVSARRTGTTSANKRKQQQRLPLPP
SPPGKLPIIGHLHLIGAETHISIRDLDAKHGRNGLLLLRIGAVPTLFVSSPSAADAVLRT
QDHIFASRPPSMAAEIIRYGPSDVAFVPYGEYWRQGRKLLTTHMLSTKKVQSFRHGRQEE
VRLVMDKIRAAATAAPPAAVDLSDLLSGYTNDVVCRAVLGASHRNQGRNRLFSELTEINV
SLLGGFNLEDYFPPNMAMADVLLRLVSVKARRLNQRWNDVFDELIQEHVQSRPSGESEES
EADFIHVLLSIQQEYGLTTDNLKAILVDMFEAGIETSYLTLEYGMAELINNRHVMEKLQT
EVRTTMRSPDGKKLDMLAEEDLGSMPYLKATIKETLRLHPPAPFLLPHYSTADSEIDGYF
VPAGTRVLVNAWALGRDRTTWEKPEEFMPERFVQEPGAVDVHMKGKDLRFIPFGSGRRIC
PGMNFGFATMEIMLANLMYHFDWEVPGSAAGVSMDESFGLTLRRKEKLLLVPRIAS*

Other information
Ka divergence:-0.180494KaKs divergence:-0.173167
GC content 1 (%):64GC content 2 (%):64GC content divergence:0
Length 1 (bp):1605Length 2 (bp):1611Length divergence:0.002
MFE 1 (kcal):-713.91MFE 2 (kcal):-722.63MFE divergence0.006