Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G063864-GRMZM2G107807
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100273857
Function (paralog2):PHD finger protein

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.093350399733893
Log2 mRNA fold difference:-0.32686889953482
Log2 TE fold difference:0.23258446351696
Sequences
Protein sequence

MDGDGGGAGALHHHTRSPEDVFRDFRARRAGIVKALTTDVEKFYQQCDPEKENLCLYGLP
NETWEVTLPAEEVPPELPEPALGINFARDGMVEKDWLSLVAVHSDAWLLSVAFYFGARFG
FDKDARRRLFTMINNLPTVYEVVTGVAKKQSKAPNGSSKSSKPNSKPSKLTNSNSKPAKP
AHPKEEEDSGREDAEEDQAYLCGSCGESYANGEFWICCDVCEKWFHGKCVRITPAKAEHI
KQYKCPSCSTKRSRE*

MDGDREGAAAVHHHARSPEDVFRDFRARRAGIVKALTTAASVVRADVEKFYQQCDPEKEN
LCLYGLPNETWEVTLPAEEVPPELPEPALGINFARDGMVEKDWLSLVAVHSDAWLLSVAF
YFGARFGFDKDARRRLFTMINNLPTVYEVVTGVAKKQSKAPNGSSKSSKSNSKPSKQINS
NSKPVKPAHPNEEEDSGREDAEEDQAYLCGSCGESYANGEFWICCDICEKWFHGKCVRIT
PAKAEHIKQYKCPSCSTKRSRE*

Other information
Ka divergence:-0.0677744KaKs divergence:0.775452
GC content 1 (%):54GC content 2 (%):53GC content divergence:-0.009
Length 1 (bp):768Length 2 (bp):789Length divergence:0.013
MFE 1 (kcal):-266.17MFE 2 (kcal):-285.53MFE divergence0.035