Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G063909-GRMZM2G064023
Species:maize
Duplication type:TD
Function (paralog1):hypothetical protein LOC100280203 (LOC100280203), mRNA
Function (paralog2):hypothetical protein LOC100194338

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.66810401490985
Log2 mRNA fold difference:-2.2664119402915
Log2 TE fold difference:1.5277997293703
Sequences
Protein sequence

MDCPKSKLWEPTYEDCLNLIARLPPVASYVYRRIFKDGKSIEADDSLDYAANLSHMLGFD
DPRMLELMRLHVTIHADHEGGNISSHTGHLVGSALSDPYLSFASSVNGLAGPLHGLANQE
ALLWLKSIIQETGSDVTTDQLKDYVWKTLKSGKVVHGFGHGVLRRTDPRYLCQREFALKY
LPEDPLFQLLSKLYEVVPPILTELGKVKNPWPNVDAHSGLLLNHFGLSETRYHTVLFGVS
RSMGVGSQLIWDRALGLPLERPKSVTMEWLENYCKNKAA*

MAFFRGLTAVSRLRSRMAQEATTLGGVRWLQMQSASDLDLKSQLQELIPEQQDRLKKLKS
EHGKVQLGNITVDMVLGGMRGMIGMLWETSLLDPEEGIRFRGLSIPECQKVLPTAVKGGE
PLPEGLLWLLLTGKVPTKEQVDALSKELLARSTVPAHVYKAIDALPVTAHPMTQFTTGVM
ALQVESEFQKAYDNGLPKSKFWEPTYEDCLNMIARLPPVASYVYRRIFKGGKSIETDNSL
DYAANFSHMLGFDDPKMLELMRLYVTIHTDHEGGNVSAHTGHLVGSALSDPYLSFAAALN
GLAGPLHGLANQEVLLWIKSVIQETGSDVTTDQLKEYVWKTLKSGKVVPGFGHGVLRKTD
PRYSCQREFALKHLPEDPLFQLVSKLYEVVPPILTELGKVKNPWPNVDAHSGVLLNHFGL
SEARYYTVLFGVSRSMGIGSQLIWDRALGLPLERPKSVTMEWLENYCNNKAA*

Other information
Ka divergence:-0.678127KaKs divergence:-0.263326
GC content 1 (%):48GC content 2 (%):48GC content divergence:0
Length 1 (bp):840Length 2 (bp):1419Length divergence:0.256
MFE 1 (kcal):-279.66MFE 2 (kcal):-487.1MFE divergence0.271