Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G064197-GRMZM2G090061
Species:maize
Duplication type:WGD
Function (paralog1):myb family transcription factor-related protein
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.47122345908085
Log2 mRNA fold difference:0.64981209741323
Log2 TE fold difference:-0.14242791048513
Sequences
Protein sequence

MFPPGLIHHRPDATAPGDGPPRSGPGGPSLVLTADPKPRLRWTADLHERFVDAVAQLGGP
EKATPKTILRTMGVKGLTLFHLKSHLQKYRLGKQSDKEGSEQSKDASYLLDAQSGMSVSP
RVAAQDMKESQEVKEALRAQMEVQRRLHEQVEQVQKRVQIRMEALEKYIDSILESACKMV
TEQFASSGFSISNPDLPEISPGGVMCGSTDTLGSSVLNQLSVSSIDSHSPGGKPSPSGME
GPTLLQKSPELKRRSS*

MILHVLVLSITNNEINRGKHILKAVKEQPAASYLLDAQSGMSVSPRVPAQDMKESQEVKE
ALRAQMEVQRRLHEQVEVQKRVQIRMEAFQKYIDSILESACKMVTEQFASSGFSISDPDL
PEISPGGVVMCGGPTDTLSSSVFNQLSVSSIGSHSPGGKPSPSPSGMECPPLLLHKSHEL
KRRSS*

Other information
Ka divergence:0.697384KaKs divergence:0.5877
GC content 1 (%):54GC content 2 (%):50GC content divergence:-0.038
Length 1 (bp):771Length 2 (bp):558Length divergence:-0.16
MFE 1 (kcal):-275.94MFE 2 (kcal):-169.1MFE divergence-0.24