Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G064580-GRMZM2G022711
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100382007
Function (paralog2):hypothetical protein LOC100274198

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MGANCCIAAKERTQPCITPLEVSAYRNVRHSPSWSFRWDNRTHIEDIMEIPTLFSNHSSG
SIRPDTKSGSIAPTEGFSNGNSLGTSPSNVSHGTKWHKSDKKMEASKVTMADPRADHPTA
SNSSLEAKLFRKSLDMSSVASDLKTSGSVPSTPPLVSRADPSSSRGHSQPTDSDSMKKAR
RSPGYQLYRQVSDSKIPSLRSLNEISSPEGRPSSSMLSVCSNDLSAAGSYAESSDGWSMR
TFSEMVATSQRERWSLDSELLGSISSKVTRTSASNSTTLPPEQEVCKLCLKLLKERSTWN
AQELAVVAVLLCGHVYHADCLDSITTEADKYDPPCPVCTHGEKCTVKLFGKLESKVKNKI
PKNVAADINPDGNSNKHQKKGRREPRLGTSSSMKVPFSRPFLRRHFSIGSRPPRSVSETD
STRKKGFWARHWRE*

MGANCCVAAKERTQPCITPIEVSTYRNVRRSPSWNIRWDNRTHIEDIMDIPTLFSNHSSG
SIHPDTKSGSIAPTEGFSNGNSLGTSPSNVFHGAKWHKSDKKMEARKVTKSDSRADRSTA
SNSSPETKLSRKSLDISSVASDLKTSVSVPSTPPLVSRADPSSSKGHSQPTDSDLMKKAW
RSPGYQLYRQVSDSKIPSLRSLNEIRSPEGRPPSSMLSACSNDLSAAGSYGESSDGWSMR
TFSEMVSTSQRERWSLDSELLGSISSKMTRSSASSSTTRPPDQDVCKLCLKLLKERSTWN
AQELAVVAVLLCGHAYHADCLDSITTEADKYDPPCPVCTHGEKFSVKLFGKLESKIKNKI
PKNVSVDINLDGNSSNKHQKKGRREPRLGTSSSMKVPFSRPFLRRHFSIGSRPPRSVSET
DSTRKKGFWARHWERVE*

www.000webhost.com

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):46GC content 2 (%):45GC content divergence:-0.011
Length 1 (bp):1305Length 2 (bp):1314Length divergence:0.003
MFE 1 (kcal):-405.12MFE 2 (kcal):-380.38MFE divergence-0.031