Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G064708-GRMZM2G078995
Species:maize
Duplication type:TD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.064047710392659
Log2 mRNA fold difference:0.10447020209816
Log2 TE fold difference:-0.19791690846463
Sequences
Protein sequence

MRPTRLLAAASSTFRRRRLYTAAAVSTVAPSSAAPPPQGAVQPLSTQFARPSPARGHGVA
DDLASSLRALLASSPTVQHAFHLLRSAALDTRLPPNELVDAVLSTVDPGSPAAVTLLSHV
LTCLSRAASDCAAAAAAYSRMVTRGVVPDAKSRTDLLVTTALGASAADALTLFDEMRGKG
CYADAKMYDVVIRACVRGGMHCDAVRLFDEMAGAGVKPDERVYAITISGLCKLRDADRAL
QVLGKMREAGFEPWELTYSSVVDVLVKVRRMDEALRLKDQMLLATGKKMDVVLATMLMHG
YCLNGEVGKALDLFDEVVSDGVTPTNVTYGVLIKGCDAEGMTDETYKLCRQMIEQGLLPS
TYEFNLVIKGLLRDKRWKDAIGLLKLVVDTGVPDVFTYGCLIHWLCKHQKLHEAVNLWDK
MKEAGVKPSIVTYHSLLLGYCEKGRMDEALKLYSEMPDKGFPPNEVTYTTLMKGYIKKKA
FDNAYALLNEMRQNGVSCGDYTYNILINGLYMVNRVCEVDEMLKRFLSEGFVPTTMTYNS
IINGFVKAGMMGSAFGMYRQMRKKGITPNIVTYTSFIDGYCRTNCCDLAVKLLIYVRRDG
IQPDIAAYNAFIDTFCKQGNMSRALHFLVLLLKDGLTPDVTVYNSFVTGYKNLKMMAEAS
KFYYSMIKQRVVADTEIYTTLIDGFSKVGNVAFALELYSEMMANHVIPDDKTFTALTHGL
CRSGDIDGAKRLLDDMRRLDVSPNIVTYNMLINACVRDGKLQEAFQLHDEMLSSGVVPDD
TTYDILPRTNNS*

MRPTRLLAAASSTFRRRRLYTAAAVSTVAPSSAAPPPQSAVQPLSTQFARPSPARGHGVA
DDLASSLRALLASSPTVQHAFHLLRSAALDTRLPPNELVDAVLSTVDAGSPAAVTLLSHV
LTCLSRAASDCAAAAAAYSRMVTRGVVPDAKSRTDLLVTTARGASAADALTLFDEMRGKG
CYADAKMYDVVIRACVRGGMHCDAVRLFDEMAGAGVKPDERVYAITISGLCKLRDADRAL
QVLGKMREAGFEPWELTYSSVVDVLVKVGRMDEALRLKDQMLLATGKKMDVVLATMLMHG
YCLHGEVGKALDLFDEVVSDGVTPTNVTYGVLIKGCDAEGMSDETYKLCRQMIEQGLLLS
TYEFNLVIKGLLRDKRWKDAIGLLELVVDTGVPDVFTYGCLIHWLCKHQKLHEAVNLWDK
MKEAGVKPSIVTYHSLLLGYCEKGRMDEALKLYSEMPDKGFPPNEVTYTTLMKGYIKKKA
FDNAYALLNEMRQNGVSCGDYTYNILINGLYMVNRVCEVDEMLKRFLSEGFVPTTMTYNS
IINGFVKAGMMGSAFGMYRQMRKKGITPNIVTYTSFIDGYCRTNCCDLAVKLLIYVRRDG
IQPDIAAYNAFIDTFCKQGNMSRALHFLVLLLKDGLTPDVTVYNSFVTGYKNLKMMAEAS
KFYYSMIKQRVVADTEIYTTLIDGFSKVGNVAFALELYSEMMANHVIPDDKTFTALTHGL
CRSGDIDGAKRLLDDMRRLDVSPNIVTYNMLINACVRDGKLQEAFQLHDEMLSSGVVPDD
TTYDILPRTNNS*

Other information
Ka divergence:-0.520317KaKs divergence:-0.676044
GC content 1 (%):50GC content 2 (%):50GC content divergence:0
Length 1 (bp):2379Length 2 (bp):2379Length divergence:0
MFE 1 (kcal):-830.33MFE 2 (kcal):-829.9MFE divergence0