Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G064753-GRMZM2G134738
Species:maize
Duplication type:WGD
Function (paralog1):Cytochrome c oxidase polypeptide Vb
Function (paralog2):hypothetical protein LOC100277708

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.79496808758684
Log2 mRNA fold difference:0.50075552248587
Log2 TE fold difference:0.27882816654417
Sequences
Protein sequence

MWRRLHTLAPALRRATAAAAGAPAASASSAARAAPLSSAAAAFRRTSPLLSGDKPASVED
VMPIATGLEREELEAELKGKKRFDMDPLVGPFGTKEEPSVVESYYNKRIVGCPGGEGEDE
HDVVWFWLKKDEPHECPVCSQYFVLKVIGDGGDPDGHDDEDDGHH*

MWRRLHTLAPALRRATAAAAGGPAVPASSAARAAPLSSAAAGFRRTSPLLSEDKPARVED
VMPIATGLEREELEAELQGKKRFDMDSPVGPFGTKEEPAVIESYYNKRIVGCPGGEGEDE
HDVVWFWLKKDEPHECPVCSQYFVLKVIGDGGDPDGHDDEDDGHH*

Other information
Ka divergence:-0.0177134KaKs divergence:-0.578667
GC content 1 (%):62GC content 2 (%):61GC content divergence:-0.008
Length 1 (bp):498Length 2 (bp):498Length divergence:0
MFE 1 (kcal):-202.83MFE 2 (kcal):-206.92MFE divergence0.01