Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G064841-GRMZM2G178254
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100192721
Function (paralog2):hypothetical protein LOC100191571

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:1.7898038554516
Log2 mRNA fold difference:1.1957422291193
Log2 TE fold difference:0.60511051039359
Sequences
Protein sequence

MAGYEQRVVAVIMVGGPTKGTRFRPLSLNVPKPLFPIAGQPMVHHPISACSRIPNLAQIY
LIGFYDEREFALYVSSISNELRIPVRYLREDKPHGSAGGLYIFRDYIMEDSPSHIVLLNC
DVCSSFPLPDMLEAHKKYGGMGTLLVNKVSAESANQFGELVADPETNELLHYTEKPETFV
SDLINCGVYIFTPNIFSAIEDVLKQKKDRANLRRVSSFEALHSATKALPPDFVRLDQDIL
SPRAGKKELYTYQTLDFWEQIKTPGMSLRCSGLYLSRFRRTSPHLLASGDGKRTATIVGD
VYIHPSAKVHPTSKIGPNVSISANARVGAGARLINCIILDGVEIMENAVVIHSIVGWKSS
IGKWSRVQGEGDQNAKLGITILGEAVDVEDEVVIVNSIVLPNKTLNVSVQEEIIL*

MAGSEQRVVAVIMVGGPTKGTRFRPLSLNVPKPLFPIAGQPMVHHPISACSRIPHLAQIY
LIGFYEEREFALYVSSISHELRIPVRYLREDKPHGSAGGLYSFRDYIMEDSPSHIVLLNC
DVCSSFPLPDMLEAHKKYGGMGTLLVNKVSAESANQFGELVADPETNELLHYTEKPETFV
SDLINCGVYIFTPDILSAIEDVLKQKKDRANLRRVSSIEALHSATKALPPDFVRLDQDIL
SPRAGKKELYTYQTLDFWEQIKTPGMSLRCSGLYLSQFRHTSPHLLASGDGKRTATIVGD
VYIHPSAKVHPTSKIGPNVSISANARVGAGARLINCIILDDVEIMENAVVIHSIVGWKSS
IGKWSRVQGEGDHNAKLGITILGEAVDVEDEVVVVNSIVLPNKTLNVSVQEEIIL*

Other information
Ka divergence:-0.0794979KaKs divergence:-0.0750777
GC content 1 (%):47GC content 2 (%):48GC content divergence:0.011
Length 1 (bp):1248Length 2 (bp):1248Length divergence:0
MFE 1 (kcal):-397.5MFE 2 (kcal):-397.97MFE divergence0.001