Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G064870-GRMZM2G038384
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100273152
Function (paralog2):reticulon

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MATGPRSLHALLGGGAVADLLLCRRRNASAAAVVGATAVWFVFERAGYSFPSVLSNALLL
LVAILFFWAKSALLLNRPLPPLPNLEVSDAVVEKAADYALVWINRLLAVGHDIAIKRNRK
VFIKVILILWLVSFVGMLFNFLTLIYIGVMLSLLVPPLYEKYQDQVDEKVGVAHSIISRH
INTIVIRAGQSAKEKKTE*

MATGPRSLHALLGGGAVADLLLWRRRNASAAAVVGATTVWFVFERAGYSFPSVLSNALLL
LVAILFFWAKSASLLNRPLPPLPNLEVSDAIVEKAANHALVWINRLLAVGHDIAIKRDRK
VFIKVILILWVVSFIGMLFNFLTLIYIGVMLSLLVPPLYEKYQDQVDEKVGVAYSVLSRH
IDTIITRAGQSAKQKKTE*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):52GC content 2 (%):52GC content divergence:0
Length 1 (bp):597Length 2 (bp):597Length divergence:0
MFE 1 (kcal):-202.12MFE 2 (kcal):-207.52MFE divergence0.013