Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G065203-GRMZM2G177150
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100382183
Function (paralog2):hypothetical protein LOC100382138

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.76637229388319
Log2 mRNA fold difference:1.6802935416807
Log2 TE fold difference:-1.1577931408831
Sequences
Protein sequence

MVFPAILPKVAVRLLFTFYRAARKLRRHAFQLYNRRTAAKPPSFSVSQQQAGAATFKTDA
AIPDAAGRTVVCDVHGALLRSSALFPYFMVVAYEGGSLLRAMLLLCAFPLVWALGERSGG
AGAVRVMAFVTFAGLRPRDMDLVGRAVLPKHYMEQLNALVYGSLWLPARRKVAVTGAPRV
MSEWFLKEYLAADAVVGLELQLVTVGRCRYFTGLLSGPATGPELRHKALMEALGAEDDTV
ADVGIISNSNPLDHLFVPYCKEVYVVNTENDKLPRVKYPKPLIFHDGRLAFLPTPAAMLA
FFLFLPLGVILSVIRINIGIVLPYKVNFVAAAIFGVRFRASGLRAPPADGEQRRGVLYVC
THRTLVDPIMLTTALQKPVPALTYSLSRLSELIAPIKTVRLTRDRARDADTMSRLLKQGD
LAVCPEGTTCREPYLLRFSPLFAELADDMEPVALDAQVTMLYGTTASGHKWLDPVAFFAN
PVPSYRVEFLGTVPREWTRAGGRTGVEVANWVQRRLGEALEFECTELTRRDKYMMLAGND
GVVAK*

MVFPAILPKVAARWLFTFYRAARKLRRHAFQLYYRNTTAAKPSSAAAAAVSQQQTGAAAT
AALKTGAAIPDAAGRTVVCEMHGALLRSTALFPYFMLVACEGGSLVRAMLLLCAFPLVWA
LGERRGAGVRVMAFVTFAGLRPRDVDLVARAVLPKHYMEQLNALVYGSLWLPARRKVAVT
SAPRVMSEWFLKEYMAADAVVGLELQHVNVGRRRYFTGLLSSSGHATGPELRQKAIREAL
LGAEDDPIAVVGIINDSSPLDDELFVPYCKEVYVVSRESAKNDKLSREKYPKPLIFHDGR
LAFLPTPAAMLAFFLFLPLGVVLSVIRINIGIVLPYKINFATAAIFGVRFRASGLRAPPA
DGKRRRGVLYVCTHRTLVDPIMLTTALQKPVPALTYSLSRLSELIAPIKTVRLTRDRARD
AETMSRLLAQGDLAVCPEGTTCREPYLLRFSPLFAELADDMEPVALDAQVTTLYGTTASG
HKWLDPVAFFANPVPSYRVEFLGAVPREWTRAGGRTGVEVANWVQRRLGQALDFECTGLS
RRDKYMMLAGNDGVVAK*

Other information
Ka divergence:-0.141039KaKs divergence:-0.0741463
GC content 1 (%):68GC content 2 (%):68GC content divergence:0
Length 1 (bp):1638Length 2 (bp):1674Length divergence:0.011
MFE 1 (kcal):-800.47MFE 2 (kcal):-787.33MFE divergence-0.008