Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G065205-GRMZM2G112074
Species:maize
Duplication type:WGD
Function (paralog1):replication licensing factor MCM7 homologue
Function (paralog2):hypothetical protein LOC100273978

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.73418705465269
Log2 mRNA fold difference:-1.1569729972698
Log2 TE fold difference:0.36320030243455
Sequences
Protein sequence

MKNPDFAADKALAKDFLSNFTGPHGEPKYLNILQDVANRKIRAVQIELDDLFHYKDVDEE
FLQRVTENTRRYIGIFAEAMDEIMPEPTEAYTVDEDQDILMTQRVDEGADGGADGTDPLQ
KMPPEIKRFFEVYIKAFSKVTPLTIRQVKASNIGQLVKISGIVTRCSDVKPLMQVAVYTC
EECGFEIYQEVTARVFMPLIECPSQRCKLNKAKGNLILQLRASKFLKFQEVKLQELAEHV
PKGHIPRALTVHLRGELTRKVAPGDVVEMSGIFLPMPYYGFRAMRAGLVADTYLEAMSVT
HFKKKYEEYDLKGDEQEQIDRLAEDGDIYSKLARSLAPEIFGHEDVKKALLLLLVGAPHR
KLADGMKIRGDLHICMMGDPGVAKSQLLKHIINVAPRGVYTTGRGSSGVGLTAAVQKDPV
TNEFVLEGGALVLADMGICAIDEFDKMEESDRTAIHEVMEQQTVSIAKAGITTSLNARTA
ILAAANPAWGRYDMRRTPAENINLPPALLSRFDLLWLILDRADMETDLEMARHVVHVHQN
LESPALGFTPLEPSVLRAYISAARRVIPSVPRELEEYIATAYSSIRQEEAKSNAPTSYTT
IRTLLSILRISIALARLRFSETVAQSDVDEALRLMQMSKYSLYSDDRQRSGLDAISDIYS
ILRDEAARTSSMDVRYAHALNLISRKGYSEAQLKECLEEYASLNVWQIHPSTFDIHFIDA
*

MKNPDFTADKALAKDFLSNFVGPHGDPKYLNILQDVANRKIRAVQIELDDLFHHKDVDEE
FLQRVTENTRRYVGIFAEAMDEIMPEPTEAYTVDEDRDILMTQRVDEGVDGGADGTDPLQ
RMPPDIKRFFEVYIKTFSKATPLTIRQVKASNIGQLVKISGIVTRCSDVKPLMQVAVYTC
EECGFEIYQEVTARVFMPLIECPSQRCKLNKAKGNLILQLRASKFLKFQEVKLQELAEHV
PKGHIPRSLTVHLRGELTRKVAPGDVVEMSGIFLPMPYYGFRAMRAGLVADTYLEAMSVT
HFKKKYEEYDLKGDEQEQIDRLAEDGDIYSKLARSLAPEIFGHEDVKKALLLLLVGAPHR
KLADGMKIRGDLHICMMGDPGVAKSQLLKHIINVAPRGVYTTGRGSSGVGLTAAVQKDPV
TNEFVLEGGALVLADMGICAIDEFDKMEESDRTAIHEVMEQQTVSIAKAGITTSLNARTA
ILAAANPAWGRYDMRRTPAENINLPPALLSRFDLLWLILDRADMETDLEMARHIVHVHQN
LESPALGFTPLEPSVLRAYISAARRVIPSVPRELEEYIATAYSSIRQEEAKSNAPTSYTT
IRTLLSILRISIALARLRFSETVAQSDVDEALRLMQMSKYSLYSDDRQRSGLDAISDIYS
ILRDEAARTSSMDVRYAHALNLISRKGYSEAQLKECLEEYASLNVWQIHPSTFDIHFIDA
*

Other information
Ka divergence:0.4869KaKs divergence:0.249695
GC content 1 (%):48GC content 2 (%):50GC content divergence:0.02
Length 1 (bp):2163Length 2 (bp):2163Length divergence:0
MFE 1 (kcal):-707.55MFE 2 (kcal):-761.42MFE divergence0.037