Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G065655-GRMZM2G130389
Species:maize
Duplication type:TD
Function (paralog1):hypothetical protein LOC100192804
Function (paralog2):hypothetical protein LOC100277626

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.7236233360495
Log2 mRNA fold difference:-3.2213808371493
Log2 TE fold difference:1.5558207759095
Sequences
Protein sequence

MATDASGGGKPSLLLSTLPKQLPSDFLKEITDGFSADRKLGQGGFGTVYKGFLQDGQAIA
VKKLSDNSPVATEKQFKNEVGNLMAIQHENIVRLYGYCHELQKKVIEHNGRYILVDVVQS
MLCYEYAPKGSLDKCIFDISSRPNWATCFKIIKGICQGLYFLHKGMDRPIVHLDLQPANI
LLDDNMVPKIADFGLSRLFGEEQTRINTINVVGAKGYMAPEYLYRGEISTRSDIYSLGVL
IMEITTGQKNSPNDKDMCARNFINQVCQTWTDEHMASKYSSLDADSLQQVKACIETGLKC
VDIDQKKRPSIVEIVDKLDGRLAL*

MANKPSLLSTLPTNPPAQFLKDITDGFSETQMLGEGAFGTVYKGILQDGQPIAVKKLAEN
APVAPEKQFKIGVGNLMAMQHPNIVRILGYCREPQRKVIEQSGRYIIVDVVESLLYYEYV
PNGNLEKYISDASASRPDWKTCFEIIKGICQGLRYLHKEMDRPIVHLDLHPTNILLDENM
VPKITDFGLSRLFGEEQTRINTINVVGKKGYMAPEYLYRGEISTRSDIYSLGLVIMEIIT
GKNSSSSDKDMSARDFVDKVRETWTDEHIASKHSALDAVSLQEVRTCIEIGLKCVDIDQN
KRPSIVEIVDKLNGRHAH*

www.000webhost.com

Other information
Ka divergence:0.416064KaKs divergence:0.557927
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):975Length 2 (bp):957Length divergence:-0.009
MFE 1 (kcal):-301.1MFE 2 (kcal):-293.53MFE divergence-0.013