Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G065868-GRMZM2G047971
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100280220
Function (paralog2):hypothetical protein LOC100193699

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MAVPLLTQKIVKKRVKQFKRPHLDRYKCLKPSWRRPKGIDSRVRRKFKGCTLMPNIGYGS
DKKTRHYLPNKFKKFVVHNVSELELLLMHNSRTYCAEIAHNVSTRKRKEIVERAAQLDIV
VTNKLARLRSQEDE*

MAVPLLTQKIVKKRVKQFKRPHLDRYKCLKPSWRRPKGIDSRVRRKFKGCTLMPNIGYGS
DKKTRHYLPNKFKKFVVHNVSELELLLMHNSRTYCAEIAHNVSTRKRKEIVERAAQLDIV
VTNKLARLRSQEDE*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):56GC content 2 (%):56GC content divergence:0
Length 1 (bp):405Length 2 (bp):405Length divergence:0
MFE 1 (kcal):-137.5MFE 2 (kcal):-135.9MFE divergence-0.006