Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G065868-GRMZM2G115901
Species:maize
Duplication type:TD
Function (paralog1):hypothetical protein LOC100280220
Function (paralog2):60S ribosomal protein L32 Fragment

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.0550035262469
Log2 mRNA fold difference:0.17760302293311
Log2 TE fold difference:-1.255462263206
Sequences
Protein sequence

MAVPLLTQKIVKKRVKQFKRPHLDRYKCLKPSWRRPKGIDSRVRRKFKGCTLMPNIGYGS
DKKTRHYLPNKFKKFVVHNVSELELLLMHNSRTYCAEIAHNVSTRKRKEIVERAAQLDIV
VTNKLARLRSQEDE*

MAVPLLTQKIVKKRVKQFKRPHLDRYKCLKPSWRRPKGIDSRVRRKFKGCTLMPNIGYGS
DKKTRHYLPNKFKKFVVHNVSELELLMMHNRTYCAEIAHNVSTKKRKEIVERAAQLDIVV
TNKLARLRSQEDE*

Other information
Ka divergence:-0.00861498KaKs divergence:0.0285714
GC content 1 (%):56GC content 2 (%):52GC content divergence:-0.037
Length 1 (bp):405Length 2 (bp):402Length divergence:-0.004
MFE 1 (kcal):-137.5MFE 2 (kcal):-128MFE divergence-0.036