Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G066051-GRMZM2G351417
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100382399
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.081799055218143
Log2 mRNA fold difference:-0.50909645964799
Log2 TE fold difference:0.34561076342043
Sequences
Protein sequence

MKGLFKSKPRTPVDIVRQTRECLVYLDLHSDSRSGDAKREEKMTELSKNIRDMKSILYGN
GESEPVTEACVQLTQEFFRENTLRLLIIHLPKLNLETRKDATQVVANLQRQQVSSKIVAS
EYLESNKDLLDILILGYENMDIALHYGAMLRECIRHQSIARYVLESEHMKKFFDYIQLPN
FDIASDASATFKELLTRHKATVAEFLSNNYDWFFEEFNSRLLSSTNYITKRQAIKLLGDM
LLDRSNAAVMMRYVSSKDNLMILMNLLRDSSKNIQIEAFHVFKLFAANKNKPPEVVNILV
TNRSKLLRFFAGFKIDKEDEQFEADKEQVIKEISAL*

MKGLFKTKPRTPVDIVRQTRECLVHLDLHSGSRSGDAKRDEKMTELSKNIRDMKSILYGN
GESEPVTEACVQLTQEFFRENTLRLLIIHLPKLNLETRKDATQVVANLQRQQVSSKIVAS
EYLESNKDLLDILILGYENMDIALHYGAMLRECIRHQSIARYVLESEHMKKFFDYIQLPN
FDIASDASATFKELLTRHKATVAEFLSNNYDWFFEEFNSRLLSSTNYITKRQAIKLLGDM
LLDRSNVAVMMRYVSSKDNLMILMNLLRDSSKNIQIEAFHVFKLFAANKNKPPEVVNILV
TNRNKLLRFFAGFKIDKEDEQFEADKEHVIKDFFPLSMSEVVISH

Other information
Ka divergence:0.458642KaKs divergence:0.345062
GC content 1 (%):42GC content 2 (%):41GC content divergence:-0.012
Length 1 (bp):1011Length 2 (bp):1035Length divergence:0.012
MFE 1 (kcal):-278.92MFE 2 (kcal):-286.2MFE divergence0.013