Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G066153-GRMZM2G131176
Species:maize
Duplication type:WGD
Function (paralog1):phosphoribosylanthranilate transferase
Function (paralog2):Putative uncharacterized protein

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.22272802783954
Log2 mRNA fold difference:-0.071704004631176
Log2 TE fold difference:-0.23105809194312
Sequences
Protein sequence

MKGATPPRPFMVPGPGGPMPPPQQQFGLVETRPPLAAVLRPRFNIPGLHPSAAAAAAASG
AGKIASTYDLVEPMRFLYVHVVKARDLPAVSATGSIDPFVEVKLGNFKGTTPVRAASHSP
SWQQVFAFSAAHLQSHLLEVALKAKDLAGDDLVGRVAFDLSEVPVRVPPDSPLAPQWYRL
ETKRGEKLPHGEIMLSVWLGTQADEAFPDAWHSDAHAAAGPAAVASTRAKVYFSPKLVYL
RVAAIAAQDLVPHDASRPMTACVKLQLAGQVRRTRPGAPPGTPNPIWNEEFMFVASEPFD
EPLLVTVEDRVAPGRDEILGRIVLPLKAAMPRHDHFGKPVEPRWYSLMRHSDDPDKKEVK
FASKIQIRMSLDFGYHVLDESTYYSSDLQPSSKPARKPSIGMLELGVLGARNLIPMKPKD
GRTTDAYCVAKYGPKWVRTRTILDTLNPQWNEQYTWEVFDPCTVITVVVFDNGQIGSKNG
GGPDQRIGKVRIRLSTLETDRVYTHFYPLLVLHPSGLKKTGELHLAVRFTCTAWVNMMAL
YGRPLLPKMHYTHPIAVMQLDYLRHQAMQIVAARLSRAEPPLRREVVEYMLDVDSHMFSL
RRSKANFHRITSLFFGFVAMLKWYHSIRSWCNPITTMLVHMLFLILICYPELILPTIFLY
MFMIGLWNYRYRPRHPSHMDTKLSHAELTHPDELDEEFDTFPSSRPAEIVRMRYDRLRSV
GGRVQAVVGDLATQGERAHALLSWRDPRATAIFIFLSLVIAVVLYVTPFQVLMVIAMLYL
LRHPRFRSRMPSVPFNFYRRLPAKSDMLL*

MKGAMPPRQFMVPGPGGPMLPPQQQFGLVETRPPLAAVLRPRFNIPGLHPSAAAAAAASG
AGKIASTYDLVEPMRFLYVHVVKARDLPAVSATGAIDPFVEGGQPQPVLAAVFAFSATHL
QSHLLEVALKAKDLAGDDLVGRVAFDLAEVPVRVPPDSPLAPQWYRLETKRGEKLPHGEI
MLSVWLGTQADEAFPDAWHSDAHAAAGPAAVASTRAKVYFSPKLVYLRVAAIAAQDLIPH
DTSRPMSACVKLQLAGQLRRTRPGAPPGTPNPIWNEEFMFVASEPFDEPLVVTVEDRVAP
GRDEMLGRIFLPLAAAMPRHDHFGKPVEPRWYSLMRPSDDPDKKEVKFASKIQIRMSLDF
GYHVLDESTYYSSDLQPSSKPARKPSIGMLELGVLGARNLVPMKPKDGRTTDAYCVAKYG
PKWVRTRTILDTLNPQWNEQYTWEVFDPCTVITVVVFDNGQIGSKNGGGPDQRIGKVRIR
LSTLETDRVYTHFYPLLVLNPSGLKKTGELHLAVRFTCTAWVNMMALYGRPLLPKMHYTQ
PIAVMQLDYLRHQAMQIVAARLSRAEPPLRREVVEYMLDVDSHMFSLRRSKANFHRITSL
FFGFLAMLKWYDGIRSWWNSITTVLVHMLFLILICYPELILPTIFLYMFMIGLWNYRFRP
RHPSHMDTKLSHAELTHPDELDEEFDTFPSSRPAEIVRMRYDRLRSIGGRVQTVVGDLAT
QGERAHALLSWRDPRATAIFVFLSLVVAVVLYVTPFQVLMVIGMLYLLRHPRFRSRMPSV
PFNFYRRLPARSDMLL*

www.000webhost.com

Other information
Ka divergence:0.104686KaKs divergence:0.125389
GC content 1 (%):60GC content 2 (%):61GC content divergence:0.008
Length 1 (bp):2430Length 2 (bp):2391Length divergence:-0.008
MFE 1 (kcal):-1018.3MFE 2 (kcal):-1035.62MFE divergence0.008