Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G066373-GRMZM2G008558
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MPSKRPSPHAMDEAASATAAAAAATARLRPSTPRSKKRTSRSKSRGRRRSPNPNPSSRRE
GSADHASAAPSRKSDRKPKPRSFPDSATLATAMASVSAAAAAAPSSGAGRGSAGAVQKLW
SEADEIALLTGAAAFKDRTGIAPRLPDMGELFDSIRDSLAPHLDQAKVYYKLKRLKSKFQ
HSVPGDSSTAHEHRLRDLGAALWGAELTRPEENAAEEAADADDIDGNREGAVKLPMVKEV
LGEYWRLNGQTMSGVSLEKGLALLGSQEASDTEVKWRRQLEADMRMQMRRHDLEKEVYGL
LIDAIKGLGP*

MPSKRPTPHAMDEAASASAAAARLRASTPRSKKRTSRSKSRGRSPNPNPSSRRERAADHG
SAAPSRKSDRKPNRSFPDSATLATAMASVPAASAPSSGGGRGSAGAVQKLWSEVDEVALL
TGAAAFKDRTGIAPRLPDMGELFESIRGSLAPHLDQAKVYYKLKRLKSKFQHSVLGDSST
AHEHRLRDLGAALWGAELTRPEENAVVTAEETTDPDEGFIDEDREGSVKLPMVKEVLGEY
WRLNGQTMSGVSLEKGLVLLGSQQASVVEVKWRRQLEADMRMQMRRHDLEKEVYGLLIDA
IKGLGP*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):69GC content 2 (%):66GC content divergence:-0.022
Length 1 (bp):933Length 2 (bp):921Length divergence:-0.006
MFE 1 (kcal):-420.41MFE 2 (kcal):-410.6MFE divergence-0.012