Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G066377-GRMZM2G081915
Species:maize
Duplication type:TD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100191280

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.35772290474975
Log2 mRNA fold difference:0.26147941531238
Log2 TE fold difference:-0.61048080490883
Sequences
Protein sequence

DPDEPNFFRKTIQRILGVQYSVPDYVHISPECQDLISRIFVANPSTRITMPEIRSHPWFL
KNLPADLVDDSATTTSKQYEEPEQPMQGMDEIMQILGEATIPAAGSRGLNQFLNDGLDLD
DDMEDLDSDADLDLESSGEIVYAM*

MDRAALTVGPGMDMPIMHDGDRYELVRDIGSGNFGVARLMRNRADGQLVAVKYIDRGEKI
DENVQREIINHRSLRHPNIIRFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEAR
FFFQQLISGVSYCHSMFVKQVCHRDLKLENTLLDGSTAPRVKICDFGYSKSSVLHSQPKS
TVGTPAYIAPEVLLKKEYDGKVADVWSCGVTLYVMLVGAYPFEDPDEPKNFRKTIQRILG
VQYSVPDYVHISPECQDLISRIFVANPSTRITMPEIRSHPWFLKNLPADLVDDSATTTSK
QYEEPEQPMQGMDEIMQILGEATIPAAGSRGLNQFLNDGLDLDDDMEDLDSDADLDLESS
GEIVYAM*

Other information
Ka divergence:-1KaKs divergence:-0.999991
GC content 1 (%):61GC content 2 (%):60GC content divergence:-0.008
Length 1 (bp):435Length 2 (bp):1104Length divergence:0.435
MFE 1 (kcal):-169.1MFE 2 (kcal):-433.42MFE divergence0.439