Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G066440-GRMZM5G893381
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100381784
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.88932574432259
Log2 mRNA fold difference:-1.0263010169609
Log2 TE fold difference:0.13916254208811
Sequences
Protein sequence

MTSSASAPASNGPRYAPPDPTLPKPWRGLIDGNTGYLYFWNPETKVTQYERPVAAVPNSP
PQPPGYSRPEERPRSSTPSERSSETTVSRPQYAPLSDNRARNDHSEPHYASGVNLSQSAP
STNQVSQAASGNQMSTEAYRAKHEITIIGNESPAPFMTFQSTCFPSDILREVLQAGFSAP
TPIQAQSWPIAMKGRDIVAVAKTGSGKTLGYLLPGFILLKRLHHNSREGPTVLVLSPTRE
LATQIQDEAIKFGRSSRISSTCLYGGAPKGPQLRELERGADVVVATPGRLNDILEMNKVS
LRQVSYLVLDEADRMLDMGFEPQIRKIVKQIPPRRQTLMYTATWPKEVRKIASDLLNNPV
QVNIGNTDQLVANKSITQHVEVIPHMEKSRRLDQILRSQDPGSKIIIFCSTKRMCDQLAR
NLSRQYGASAIHGDKSQAERDSVLNDFRSGRCPVLVATDVAARGLDIKDIRIVVNYDFPT
GVEDYVHRIGRTGRAGATGSAYTFFGDQDSKYASELVKILEGANQSVPPQLKEMALRGGY
GGRSRRWASSDDSYGSQGYGAKRSTDSFKNSSFGNQAGGGSSFHSSFHNSSSGNQFGDTT
SFHASYGNSSQNNQTGDNPSFPPSSSNNQSGDGLSFHERFYGSRGRDESRSNNDGFRARS
RSPGKPVEVSNW*

MASSASAPASTGPRYAPPDPTLPKPWRGLIDGNTGYLYFWNPETKVTQYERPVAAVPAPQ
SQPLVYSRPDDVPRSSAPAEQRSEAAVSRPQFVPPSDNRTRIDHSESSSASGVNLSQSAL
STNQVSQYANGSQMSTEAYRAKHEITIVGNEAPAPFMTFQSTGFPSEILREVLQAGFSAP
TPIQAQSWPIALRGRDIVAVAKTGSGKTLGYLLPGFILLKRLQHNSREGPTV

Other information
Ka divergence:-0.129372KaKs divergence:-0.0978179
GC content 1 (%):49GC content 2 (%):55GC content divergence:0.058
Length 1 (bp):2019Length 2 (bp):696Length divergence:-0.487
MFE 1 (kcal):-701.16MFE 2 (kcal):-239.2MFE divergence-0.491