Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G066460-GRMZM2G179976
Species:maize
Duplication type:WGD
Function (paralog1):60S acidic ribosomal protein P0
Function (paralog2):hypothetical protein LOC100273601

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-2.2451179977008
Log2 mRNA fold difference:-1.8303250653324
Log2 TE fold difference:-0.37139342871859
Sequences
Protein sequence

MAIKRTKAEKKIAYDKKLCSLLDEYTKVLIALADNVGSKQLQDIRRGLRGDSVVLMGKNT
LIRRCIKVYAEKTGNHTFDPLMDLLVGNVGLIFTKGDLKEVREEVAKYKVGAPARVGLVA
PVDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGEKVGSSESALLAK
LGIRPFSYGLQVTSVYEDGSVFSPEVLDLSEEDLIEKFATGVSMVASLSLAISYPTLAAV
PHMFINGYKNVLAVAVETDYSYPHADKIKEYLKDPSKFAVAAPVAAGDSGAAAAPKEEEK
AAEPEEESDEEMGFSLFDD*

MAIKRTKAEKKIAYDKKLCSLLDEYTKVLIALADNVGSKQLQDIRRGLRGDSVVLMGKNT
LIRRCIKVYAEKTGNHTFDPLMDLLVGNVGLIFTKGDLKEVREEVAKYKVGAPARVGLVA
PVDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGEKVGSSESALLAK
LGIRPFSYGLQVTSVYEDGSVFSPEVLDLSEEDLIEKFATGVSMVASLSLALSYPTLAAV
PHMFINGYKNVLAVAVETDYSYPHADKIKEYLKDPSKFAVAAPVAAADSSAAAAPKEEEK
APEPAEESDEEMGFSLFDD*

Other information
Ka divergence:-0.587484KaKs divergence:-0.582734
GC content 1 (%):58GC content 2 (%):57GC content divergence:-0.009
Length 1 (bp):960Length 2 (bp):960Length divergence:0
MFE 1 (kcal):-386.74MFE 2 (kcal):-375.24MFE divergence-0.015