Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G066496-GRMZM2G109785
Species:maize
Duplication type:WGD
Function (paralog1):ACT domain containing protein
Function (paralog2):hypothetical protein LOC100383740

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.86590517418624
Log2 mRNA fold difference:0.21774053979564
Log2 TE fold difference:-1.079832297629
Sequences
Protein sequence

MALAASHHRLLPVAPTPAATRTPSRGHLRFRAARPLPRSRRICCQSINSTNVLGASSKTS
DEAIPVPVVQIDQDSDRDATIVQLSFGDRLGALLDTMKALKDLGLDVSKGSVATDSAVTQ
TKFHIMRFGRKVEDPDMLERIRLTIINNLLQYHPESSEKLAMGEFFGIKPPVKKVDIDIA
THIVVEDDGPKRSMLYIETADRPGLLLEIIKIIADTNIDVESAEIDTEGLVAKDKFHVSY
RGAKLNSSSSQVLINCLRYYLRRPETDEDSY*

MALAASHHGLLPFAPAATPTPSRGHLRFRAARPLPRPARRICCQSINSANVLGASSTTSD
EAVPVPVVQIDQDSDRDATIVQLSFGDRLGALLDTMKALKDLGLDVTKGSVTTDSAVTQT
KFHIMRFGRKVEDPDMLERIRLTIINNLLQYHPESSEKLAMGEFFGIKPPEKKVDVDIAT
HIVVEDDGPKRSILYIETADRPGLLLEIIKIIADTNIDVESAEIDTEGLVAKDKFHVSYR
GGKLNSSLSQALTNCLRYYLRRPETDEDSY*

Other information
Ka divergence:-0.130847KaKs divergence:-0.181028
GC content 1 (%):49GC content 2 (%):50GC content divergence:0.01
Length 1 (bp):816Length 2 (bp):813Length divergence:-0.002
MFE 1 (kcal):-252.9MFE 2 (kcal):-247.29MFE divergence-0.011