Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G066528-GRMZM2G162284
Species:maize
Duplication type:WGD
Function (paralog1):HMG-like nucleosome/chromatin assembly factor D
Function (paralog2):LOC100284781

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-2.9253476649784
Log2 mRNA fold difference:-4.5400207027207
Log2 TE fold difference:1.6381804083404
Sequences
Protein sequence

MKSRARSTAGDSRLSVRKTKAEKDPNKPKRPPSAFFVFMEEFRKDYKEKHPNVKQVSVIG
KAGGDKWKSLSDAEKAPYVSKAEKLKAEYTKKIDAYNNKQSGDPTASGDSDKSKSEVNDE
DEEGDE*

MLLVWVVADGFIGFGSVGLEMKSRARSGGGDSRLSVRKTKVEKDPNKPKRPPTAFFVFME
EFRKDYKEKHPNVKQVSVIGKAGGDMWKSLSDAEKAPYVSKAEKLKVEYTKKMDAYNNKQ
SGGGPTLSGDSDKSKSEGDE*

Other information
Ka divergence:0.233142KaKs divergence:-0.042204
GC content 1 (%):56GC content 2 (%):52GC content divergence:-0.037
Length 1 (bp):381Length 2 (bp):423Length divergence:0.052
MFE 1 (kcal):-121.5MFE 2 (kcal):-130.31MFE divergence0.035