Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G067049-GRMZM2G075496
Species:maize
Duplication type:WGD
Function (paralog1):Putative uncharacterized protein
Function (paralog2):hypothetical protein LOC100217187

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.60170533616614
Log2 mRNA fold difference:1.3979054293267
Log2 TE fold difference:-0.78858390682254
Sequences
Protein sequence

MTESEGEAEAARAAVLTPPLSLGAGGLAGELRPANLGQRVLSLFRNVRPGSDLSHFQLPA
TFNLPKSQLQLYGEAVYCGGEDMLARCARGADSLQRMCAVVAWSISTTRPPIFGFAPYNP
VLGETHHVSTSAGLNVLLEQVSHRPPVTALHATHARGEVELVWCQSPAPRFHGASVEAAV
RGARELRLPRHAETYAVGCPGLVIRLLPSPGCEWAGDVRVSCAESGLEATLSYRRSRRSF
LGLGGGDARCVRGRVFRSAAPDDTLCEVDGFWDRQVSLRDVATGEVSVLYDARQTIADLA
TPVVQDRKGVSASESAVVWAEVSAAILNKDWEAARQAKRRVEETARRLAKERNERGEVWT
PSHFSLWQNKHGDWECWPLEDSVPPAPIVVPSPL*

MYLLDLFTNNVESEDEAEAACAVVLTPPLSLEGGLAAELRPANLAQRVLSLFLNVRPGSD
LSHFQLPATFNLPKSQLQLYGEGVYCAGEDLLGRCARGRDSLERLACVVAWSISTTRPPI
FGFAPYNPVLGETHHVSTTSGCGGGLNVLLEQVSHRPPVTALHATDARGEVRLVWCQSPA
PRFHGASVEAAVRGARELRLLRHAETYVIGCPGLLIRLFPSPACEWSGDVRVVCAESGLE
AQLSYCRTRRSFLGFGGGDARCVRGRIFRSAEPGDTLCEIDGFWDRQVTRRDLATGEVSV
LYDAQRAIGDLATPVVQDRKGVSASESAVVWGEVSNAILKKDWETAQQAKRRVEDTARRF
AKERNDRGEVWTPKHFSLSQNKSGDWECWPLEDSVPPAPIVVPSSSSSS*

Other information
Ka divergence:-0.220735KaKs divergence:-0.0544747
GC content 1 (%):73GC content 2 (%):71GC content divergence:-0.014
Length 1 (bp):1185Length 2 (bp):1230Length divergence:0.019
MFE 1 (kcal):-692.92MFE 2 (kcal):-673.57MFE divergence-0.014