Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G067235-AC205057.3
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100275190
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MPSPIAACFRCAAAPSSGAGAAGPSLTTSVYETHLGLVALSWSRTSLGLSLRAVLRLSPP
PSPGFSSASGAGYLDDDADEETLAFRVRPWLLWRWRGSKRFRADDRIVDLAWDLSRARFP
GSGSPEPSSGFFVAVIIDGEMVLAVGDLSDAAYRRTRARRPSGPRPVLLSRREHVSLRDA
GAGRGRSHTTCVTVQGKEREISVDLVARGLGTDRVAAGREKAKDRADVGMSVSVDGERVL
HVRRLRWKFRGSERVDLGGGNGVQVSWDLHNWLFRPREPGPAEASTHAHAHAVFVFRFDV
SSGGEDLGKDPCPDNATGRNTDVVWGGYLARWRQRDWSETGSNAERRKGRGRRLAKESSS
SSASVASSTASWASGSTVMDWGSPEEAEMQRGDGLTLLIYAWKS*

MYAEVPQEAIYTLQPRLQESKILIMRKIYVDNAKLSFKPVHGKYMIRLHPKTLLEEVNED
PQDFPKYTFHLTPFPELPQLEGNNEYFIDVIGCITALSDATPFQTSSGIVRMKRLIHLVD
LRGNKIEVSLWGRRAEEFPGQQVFKASEMNHVIVIFVGTSVKSYRGSPPFLSGTAACRWY
INLPEIHEINTFYASIGEQYQSIQKLHIQTMNEMQNKIEQKTFLEMKLVDPFDDMSKRFE
CTMIVTRIADNKPWFYQGCTKCNTSTRYEGKTYICKQGHISSQMVHRYKISLYATDGTYE
LEFVLFDERATSLIGKTVEKLLRQSNKSELPEEIKAIVGEKLTVVTKLFPGKSIKKRGPN
KDNKDPTFDILSIKKRHGKDLLLSVFKKEEPVVLHSASSSQLPKLPPLVPIEPKTQDIQT
SGSEAASPHELQLMEIDQTSCFDNLSVSYKRNFNAIDDSDKEETHGADQLSVFAKRPKMK
NN*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):71GC content 2 (%):39GC content divergence:-0.291
Length 1 (bp):1215Length 2 (bp):1449Length divergence:0.088
MFE 1 (kcal):-650.3MFE 2 (kcal):-348.73MFE divergence-0.302