Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G067242-GRMZM2G066615
Species:maize
Duplication type:WGD
Function (paralog1):Putative uncharacterized protein
Function (paralog2):hypothetical protein LOC100194134

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MAAAAAAKAAAAAVSAGAAFVLSSERAHADGGGSTFRFPGFYSSAPSPAPAPAPAPAAPP
PQESNAPEEAPKVSTQHPRTSAAGFDPAPLERGVEAINKLKQASDPKKLFEFMKKQEETH
QQEIAAKKLELQKALAEIELEQKRVDFEERKKLDQQRAKIKSQMAQYEDELKRKRLQAEH
EAQRLRNQELVKMQEESGIRLEQIRRATEEQIQEQRRQTERHRADLEQATISKKAMAEAE
GRILVTRQTEDVKRRLILEEINADREKWIQVINTTFEHIGGGLRTILTDQNKLVVAVGGV
TALAAGIYTTREGARVVWGYVDRILGQPSLIRESSRGKYPWSGFLSRATSTLTSKLKNGS
NLGKDRNGFGDVILNPSLQKRVKQLANATANTKLHQAPFRNMLFYGPPGTGKTMAARELA
RNSGLDYALMTGGDVAPLGSQAVTKIHQLFDWAKKSNRGLLLFIDEADAFLCERNKTYMS
EAQRSALNALLFRTGDQSKDIVLALATNRPGDLDSAVADRIDEVLEFPLPGEDERFKLLK
LYLDKYIIKAGDKHEKSWLQFFRRQPQKIEVKGITDDLIREAASRTQGFSGREIAKMMAS
VQAAVYGSKDCELTPGLFREVVDYKVAEHKQRRRLAGEEPKQDA*

MAAAAKAAAVAVSAGAAFVLSSERAHADGGSSTFRFPGFYSSAPAPAPPPAAPPHQQPPP
PSGGQREEAPEEAPKVSTQHPRTSAAGFDPAPLERGVEAIDKLKQSSDPKKLFEFMKKQE
ETHQQEIAAKKLELQKAVAEIELEQKRVDFEERKKLDQQRAKFKSQTAQYEDELKRKRLQ
AEHEAQRLRNQELVKMQEESGIRLEQIRRATEEQIQEQRRQTERQRADLEQATLSKKAMA
EAEGRILVTKQTEDVKRRLLLEEINADREKWIQVINTTFEHIGGGLRTILTDQNKLVVAV
GGVTALAAGIYTTREGARVVWGYVDRILGQPSLIRESSRGKYPWSGSLSRATSTLTSKLK
SGSNLGKDGNGFGDVILNPSLQKRVKQLANATANTKLHQAPFRNMLFYGPPGTGKTMAAR
ELARNSGLDYALMTGGDVAPLGSQAVTKIHQLFDWAKKSNRGLLLFIDEADAFLCERNKT
YMSEAQRSALNALLFRTGDQSKDIVLALATNRPGDLDSAVADRIDEVLEFPLPGEDERFK
LLKLYLDKYVIRAGDKREKSWLRFFRRQPQKIVVKGVTDDLIREAAAKTQGFSGREIAKM
MASVQAAVYGSKDCELTPGLFREVVDYKVAEHQQRRRLAGEEPKQDA*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):53GC content 2 (%):55GC content divergence:0.019
Length 1 (bp):1935Length 2 (bp):1944Length divergence:0.002
MFE 1 (kcal):-704.06MFE 2 (kcal):-743.81MFE divergence0.027