Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G067456-GRMZM2G148646
Species:maize
Duplication type:TD
Function (paralog1):hypothetical protein LOC100192723
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.20840810161264
Log2 mRNA fold difference:-1.6643059991496
Log2 TE fold difference:1.8870296895566
Sequences
Protein sequence

MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVTDVIHDPGRGAPLAK
VTFRHPFRYKHQKELFVAAEGMYTGQFVYCGRRATLSIGNVLPLRGIPEGAVVCNVEHHV
GDRGVFARASGDYAIVISHNPDNGTSRIKLPSGAKKIVPSSCRAMIGQVAGGGRTEKPML
KAGNAYHKYRVKRNSWPKVRGVAMNPVEHPHGGGNHQHIGHASTVRRDAPPGQKVGLIAA
RRTGRLRGQAAATASKADKAT*

MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVTDVIHDPGRGAPLAK
VTFRHPFRYKHQKELFVAAEGMYTGQFVYCGRRATLSIGQRPAAPRGSPRGAVVCNV*

Other information
Ka divergence:1KaKs divergence:0.998782
GC content 1 (%):64GC content 2 (%):68GC content divergence:0.03
Length 1 (bp):786Length 2 (bp):354Length divergence:-0.379
MFE 1 (kcal):-346.9MFE 2 (kcal):-147.4MFE divergence-0.404