Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G067583-GRMZM2G154508
Species:maize
Duplication type:WGD
Function (paralog1):tat pathway signal sequence family protein
Function (paralog2):LOC100283885

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:2.6048081636813
Log2 mRNA fold difference:2.4435626906857
Log2 TE fold difference:0.15634071497336
Sequences
Protein sequence

MMAVSLQLRPIPRLPPSRNRCAGTSPRMAALSCRYNQPTNVQGRTRLTSHITRRDALSFM
SSGVLAAFVLVVASPAEARPSRLENKRKALEKLEKLREKALGPKEKSGATGNGKEMPPPA
NLLIPPAAVEAFL*

MMAVTSLQLRPTPRLLPARNSSTGTGPRMAALSCRHNQSTNVQGRTGLRSHVTTRRDALS
FVSSALLAALFVVAGAAEARTSRLENKKKALEKLREKALGRKEENGATGGKKMPPPTNLL
IR*

Other information
Ka divergence:0.182161KaKs divergence:0.247284
GC content 1 (%):59GC content 2 (%):59GC content divergence:0
Length 1 (bp):402Length 2 (bp):369Length divergence:-0.043
MFE 1 (kcal):-145.2MFE 2 (kcal):-145.2MFE divergence0