Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G067707-GRMZM2G401139
Species:maize
Duplication type:WGD
Function (paralog1):Putative uncharacterized proteinUbiquinol-cytochrome c reductase complex ubiquinone-binding protein QP-C ;
Function (paralog2):Putative uncharacterized proteinUbiquinol-cytochrome c reductase complex ubiquinone-binding protein QP-C ;

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.3840526225659
Log2 mRNA fold difference:-0.55252549439979
Log2 TE fold difference:0.1574638494364
Sequences
Protein sequence

MGKTPVRMKAVVYALSPFQQKVMPGLWKDITTKIHHKVTENWISATLLLTPVVGTYQYAM
WYKEQEKLSHRY*

MGKTPVRMKAVVYALSPFQQKVMPGLWKDITTKIHHKVTENWISATLLLTPVVGTYQYAM
WYKEQEKLSHRY*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):59GC content 2 (%):58GC content divergence:-0.009
Length 1 (bp):219Length 2 (bp):219Length divergence:0
MFE 1 (kcal):-78.6MFE 2 (kcal):-77.7MFE divergence-0.006