Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G067752-GRMZM2G009136
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100193535
Function (paralog2):annexin A4

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MASLTLPPAPPNPRQDAIDLQKAFKGFGCDSTTVINILTHRDSVQRGLIQQEYRAMYHEE
LSHRISSELNGNHKKAMLLWILDPAGRDATVLREALSVDTMDLRAATDIICSRTPSQLQI
MKQTYYARFGTYLEHDIGHHTSGDHQKLLLAYVGIPRYEGPEVDPTIVTHDAKDLYKAGE
KRLGTDEKTFIRVFTERSWAHLASVSSAYHHMYDRKLEKVIKSETSGNFEFALLAILRCA
ENPAKYFAKLLRKAMKGLGTDDKTLIRVVVTRTEIDMQYIKAEYFKKYKKPLAEAIHSET
SGNYRTFLLSLVGPGH*

MASLTLPPAPPNPRQDAIDLHKAFKGFGCDSTTVINILTHRDSVQRGLIQQEYRAMYHEE
LSHRISSELSGNHKKAMSLWILDPAGRDATVLREALNGDTMDLRAATEIICSRTPSQLQI
MKQTYYARFGTYLEHDIAHHTSGDHQKLLLAYMGIPRYEGPEVDPTIVTHDAKDLYKAGE
KRLGTDEKIFIRVFTERSWAHLASVSSAYHHMYDRKLEKVIKSETSGNFEFALLTILRCA
ENPAKYFAKLLRKAMKGLGTDDMTLIRVVVTRTEIDMQYIKAEYLKKYKKPLAEAINSET
SGNYRTFLLSLVGHGH*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):45GC content 2 (%):45GC content divergence:0
Length 1 (bp):951Length 2 (bp):951Length divergence:0
MFE 1 (kcal):-278.06MFE 2 (kcal):-275.8MFE divergence-0.004