Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G068059-GRMZM2G407347
Species:maize
Duplication type:TD
Function (paralog1):
Function (paralog2):Anamorsin homolog (Fe-S cluster assembly protein DRE2 homolog)

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.40656051203059
Log2 mRNA fold difference:2.6290968789848
Log2 TE fold difference:-2.1600706579618
Sequences
Protein sequence

MSAALAVTDEVALPIRAVGDLAAAAEVSREEVAVITQCAALGGKLPFEDASVGAVLAVIK
NVESLREQLVAEISRVLKAGGRVLVQSPAPSSSQKPNTEIERKLLMGGFAEVQSSAANSQ
DSVQSVTVKAKKASWSMGSSFPLKKTTKALPKIQIDDDSDLIDEDSLLTEEDLKKPQLPV
VGDCEVGAAKKACKNCTCGRAEAEEKVGKLELTAEQINNPQSACGSCGLGDAFRCGTCPY
RGLPPFKPGEKVSLSGNFLAADI*

MSAALAVTDEVALPIRAVGDLAAAAEVSREEVAVITQCAALGGKLPFEDASVGAVLAVIK
NVESLREQLVAEIRRVLKAGGRVLVQSPAPSSSQKPNTDIERKLLMGGFAEVQSSAASSQ
DSVQSVTVKAKKASWSMGSSFPLKKTTKALPKIQIDDDSDLIDEDSLLTEEDLKKPQLPV
VGDCEVGAAKKACKNCTCGRAEAEEKVGKLELTAEQINNPQSACGSCGLGDAFRCGTCPY
RGLPPFKPGEKVSLSGNFLAADI*

Other information
Ka divergence:-0.473592KaKs divergence:-0.0321577
GC content 1 (%):54GC content 2 (%):54GC content divergence:0
Length 1 (bp):792Length 2 (bp):792Length divergence:0
MFE 1 (kcal):-313.6MFE 2 (kcal):-311.6MFE divergence-0.003