Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G068340-GRMZM2G101635
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100193479
Function (paralog2):LOC100280496

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.16684931521971
Log2 mRNA fold difference:-0.22723111232992
Log2 TE fold difference:0.093402391167253
Sequences
Protein sequence

MDGAPKILEKSSHECMYSWYFTREELEKFSPSRKDGITENKESEIRHLYCSFIRDVGIRL
KLPQMTLATAIMLCHRFYLHQSLAKNGWQTIATVCVFLASKVEDTPCPLDYVVRVSYETM
YRRDTAAAQRIRQKDVFEKQKALILIGERLLLTTIRFDFNIQHPYRPLLDAMQNLGINKK
EVKQVAWNFVNDWLKTTLCLQYKPQYIAAGSLYLAARLHDIKLPLHGAHVWWHQFGVAPK
PLEAVIHQMMELAAVNKSNPVRPNLVKPKETLCEAKLSLSNSPDSVLNQSSLLISSSSPD
IGETSDQVQVDSCQYLISSHTGDCRVSCPDNSSLDTSGKAHDEERLDQALITKHDSGMMP
STSNQTSLDATVGTESSAEYMKQDVSHCDDFNIRVNDQSLNQALRNQHGDAVPLPDMVSL
DAKVDKESSWCLEPLIANFDCCIDSVNVDSLCTDQRLADVASGPTADVPSVLLAKENSDP
LSAKLENIDVARIKGLLMKRKSRREIQNQAIASDGLSEEAWIERELESGIVTKQEANCAA
ISDELSDEAWIERELESGIVTGPTNEQAITFDGLSENDWIERELESGIIIEPAPAIKKRK
LESSC*

MDGVPNILEKSSHECMYSWYFTREELEKFSPSRKDGITENKESEIRHLYCSFIRDVGIRL
KLPQMTLATAVMLCHRFYLHQSLAKNGWQTVATVCVFLASKVEDTPCPLDHVVRVAYETM
YRRDTAAAQRIRQKDVFEKQKALILIGERLLLTTIRFDFNIQHPYRPLLDAMQNLGINQK
EVKQVAWNFVNDWLKTTLCLQYKPQYIAAGSLYLAAKLHNIKLPLHGAHVWWHQFDVAPK
PLEAVIHQMMELAALKKLMPARPNPVKLKETLCEAKLSLSNSPDSVLNQSNLLISSSSPD
IGEPSDKVQVDSCQYLISSHMGDCRVSGPDSSSLNTCANRNVSCKAHDEESLDQALIIKH
DSGMMPSSNQTSLYATVGTEGSAELKQDVSHCNDFNIRVNDESLNQVLRNQHGDAIPLPD
VVSLDAKVDKERSWCVEPLIANSDCCTDSVNVDSLCTDQRLADAPSGPTADAPSMLAEEE
SYPFSAKLENIDVARIKGLLMKRKSRREIQDRAIASDGLSEEDWIERELESGIVTNQEAN
CAAISDELSDEAWIERELESGIVVGPRNEQAITFDGLSEDDWIERELESGIIVEPAPATK
KRKLESSC*

Other information
Ka divergence:-0.303747KaKs divergence:-0.179958
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):1818Length 2 (bp):1827Length divergence:0.002
MFE 1 (kcal):-571.51MFE 2 (kcal):-584.11MFE divergence0.011