Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G068657-GRMZM5G821611
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100274096
Function (paralog2):palmitoyltransferase ZDHHC9

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.5711878007548
Log2 mRNA fold difference:-0.89721489901798
Log2 TE fold difference:-0.66967128789028
Sequences
Protein sequence

MYVPPPPTGGAGEQPRVYQVWRGSNEFFLQGRFIFGPDVRSVFLTMFLIIAPVVVFCVFV
ARHLINDFPDSWGISVMVVVVVFTVYDLTLLLCTSGRDPGIIPRNTHPPEPESIDGINDT
GVQTPQQFRLPRTKEVVVNGISVRVKYCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVG
QCIGLRNYRFFYMFVSSTTLLCLYVFAFCWVYVIKIRAAEHLSIWKALLKTPASIVLIIY
CFLCVWFVGGLSVFHLYLMGTNQTTYENFRYRYDRRDNPYNRGTLNNFLEIFCTAIPPSK
NNFRARVTVEQGLQQTRSQSRGFMSPSMGKPTIGELEMGRKPVVPWDEPRTAADIRDLEA
GFGGMFDEKEGRVAHASPDLSRDLPAEFVEGRTGMHSRQSSWVQRGGDASEASALQMATV
HTAEDSNHVPWSGTR*

MYMPPPPPTGGAGEQPRLYQVWRGSNEFFLQGRFIFGPDVRSVFLTMILIIAPVVVFCLF
VARHLINDFPDSWGISVMVVVVVFTIYDLTLLLCTSGRDPGIIPRNSHPPEPESIDGIND
TGVQTPQQFRLPRTKEVLVNGISVRVKYCDTCMLYRPPRCSHCSICNNCVERFDHHCPWV
GQCIGLRNYRFFYMFVFSTTLLCLYVFAFCWVYVIKIRAAEQSSVWKALLKTPASVALII
YCFLCVWFVGGLSVFHLYLMSTNQTTYENFRYRYDRRDNPYNKGVLNNFLEIFCTAIPPS
KNNFRARVTAGQGLQQTRSQSRGFMSPSMGKPIGDLEMDRKPVAPWDEPRTAADIRDLEA
GLGVMFDEKEGRVAHASPDLSRDLPAEFVEGRSGMHSRQSSWVQRGDAIEASAVQMANAR
TTEASNNVAWSGTH*

Other information
Ka divergence:0.369019KaKs divergence:0.310604
GC content 1 (%):49GC content 2 (%):49GC content divergence:0
Length 1 (bp):1308Length 2 (bp):1305Length divergence:-0.001
MFE 1 (kcal):-459.62MFE 2 (kcal):-467.77MFE divergence0.009