Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G068690-GRMZM2G162347
Species:maize
Duplication type:WGD
Function (paralog1):CTD-phosphatase-like protein
Function (paralog2):hypothetical protein LOC100381584

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.42440815442069
Log2 mRNA fold difference:-0.29271879412993
Log2 TE fold difference:0.71442778340192
Sequences
Protein sequence

MNKMLSNDCLGTQEPHTFCKTTETLEHSHPQEVTLDKTVAGSTLISHQNVCCTAGVSGEN
AEIMEITLLHDESDAGSTSLLPPLLSYGPRSMVPIQVPSSSDLESILSPDPVCSDLQLKE
INYNAAAMDESTELLHLILGGNDEGYNTTTELQVWDVLDFYVSENFSALQFDSLMGFTNE
VSTSYNDCMNLVDMVEWPVARLSLDDTPKLSNSDDAVLADNVTTDPDETSLYLRTKPTDS
ETESSSDAGDVETEYLDQKLLSRCLPDLMDVDSPNHLLKTPVRTKHVTLVLDLDETLVHS
TLDQCDSADFTLEVFFNMKNHTVYVKKRPYLKVFLEKVAQMFELVIFTASQRIYAEQLID
KLDPDGKYISRRIYRESCIFSDGCYTKDLTILGIDLAKVAIVDNTPQVFQLQVDNGIPIK
SWFDDPADQELIELLPFLESLVDSDDVRPIISKAFHDKPE*

MCSNDVCCIAELSGENTEIMEISLLHNESDAGSTSLLPLPLLSYGPRSMVPIQVPPSSDF
ESILSPEPIYSDLQLKEMNYNAAAMDESTEFLHLILSGNDEGYNSTTELQVWDVVDFYVS
ENFSALQFDSLMGFTNEVSTSYNDCMNLVDMVERPVARLSLDDTPKPSNSDDAVPADNVT
MDPDETSLYLQTKPTDSETESSSAAGDVETEYLDLKLLSRCMPDLMDVDSPNCLSKTPVK
KKHVTLVLDLDETLVHSTLDHCDNADFTLEVFFNMKNHTVYVRKRPYLKMFLEKVAQMFE
VVIFTASQRVYAEQLIDKLDPDGKYISRRIYRESCVFSDGCYTKDLTILGIDLAKVAIVD
NTPQVFQLQVDNGIPIKSWFDDPSDQELIELLPFLESLVDSEDVRPIISKTFHDKLEQN*

Other information
Ka divergence:-0.170528KaKs divergence:-0.133857
GC content 1 (%):42GC content 2 (%):40GC content divergence:-0.024
Length 1 (bp):1383Length 2 (bp):1260Length divergence:-0.047
MFE 1 (kcal):-396.58MFE 2 (kcal):-347.2MFE divergence-0.066