Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G068703-GRMZM2G177617
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):acid phosphatase/vanadium-dependent haloperoxidase related

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.69238746751126
Log2 mRNA fold difference:0.71229427980722
Log2 TE fold difference:0.0026562850889059
Sequences
Protein sequence

MSSLSATVGSLAVAVGQREGADSSAFALALVFAAVVMYDASGIRWHTGRQAALLNQIVCE
FPAEHPIISTFRPLREPLGHSPLQVFAGALVGCAVAYFMGKSV*

MRGSEMLTAAGGAGTAPSTVSSGAAAAADLVAGAGGTGAIGAGGGGGNFPLAVALLAFAF
ANFVNLVSIWLKEKRWDARKFLTSAGVMSSLSATVGSLAVAVGQQEGADSSAFALALIFA
AVVMYDASGIRWHTGRQAALLNQIVCDFPPEHPIISTFRPLREPLGHSPLQVALLHTSIF
YSWMQVFAGALVGCAAAYFMGKSV*

Other information
Ka divergence:-0.211028KaKs divergence:0.090269
GC content 1 (%):48GC content 2 (%):54GC content divergence:0.059
Length 1 (bp):312Length 2 (bp):615Length divergence:0.327
MFE 1 (kcal):-90.9MFE 2 (kcal):-225.69MFE divergence0.426