Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G068952-GRMZM2G007695
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100191314
Function (paralog2):hypothetical protein LOC100191607

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MAAGARPLVSVRALEGDMATDSVGVPLPDVLRAPIRPDIVRFVHKLLSCNSRQPYAVSRR
AGHQTSAESWGTGRAVSRIPRVPGGGTHRAGQGAFGNMCRGGRMFAPTKIWRRWHRRVNI
HLRRVAIASALAATAVPSLVLARGHRVEYVPELPLVVSDSAESIEKTAQAIKVLKQLGAS
ADADKAKDSVSIRPGKGKMRNRRYINRKGPLIVYGAEGSKIVKAFRNLPGVDVANVERLN
LLDLAPGGHLGRFVIWTECAFKKLDEVYGTFDTPSAKKKGFLLPRPKMANADLSRLINSD
EVQSVVKPINKEVKRREPRKNPLKNMAAVLKLNPYLGTARKMAALAEAARVKARKQKLDS
KRTKLSPEETSKVKAAGKAWYKTMISDSDYTEFENFTKWLGVTQ*

MAASARPLVTVRALEGDMATDSAGVPLADVLRAPIRPDIVRFVHKLLSCNSRQPYAVSRR
AGHQTSAESWGTGRAVSRIPRVPGGGTHRAGQGAFGNMCRGGRMFAPTKIWRRWHRRVNI
HLRRVAIASALSATAVPSLVLARGHRVESVPELPLVVSDSAESIEKTAQAINILKQLGAY
ADAEKAKDSVGIRPGKGKMRNRRYINRKGPLVVYGTEGSKVVKAFRNLPGVDVANVERLN
LLDLAPGGHLGRFVIWTECAFKKLDEVYGTFNAPSAKKKGFVLPRPKMANADLSRLINSD
EVQSVVKPINKDVKRREPRKNPLKNMAAVLKLNPYLGTARKMAALAEAARVKARKQKLDS
KRTKLSPEEASKVKAAGKAWYKTMVSDSDYTEFENFTKWLGVTQ*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):62GC content 2 (%):61GC content divergence:-0.008
Length 1 (bp):1215Length 2 (bp):1215Length divergence:0
MFE 1 (kcal):-516.6MFE 2 (kcal):-513.5MFE divergence-0.003