Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G068967-GRMZM2G438202
Species:maize
Duplication type:WGD
Function (paralog1):ethylene-responsive transcription factor 4
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.3844662744105
Log2 mRNA fold difference:0.98626382741282
Log2 TE fold difference:-2.7640977051585
Sequences
Protein sequence

MAPKNALPAASGMTLEPRYRGVRKRPWGRYAAEIRDPARKARVWLGTFDTAEAAARAYDA
AALHFRGPKAKTNFPVAFATATATDTRALPLPLRLPLPPPPPPKKLAVSPSGSTVESSSR
DSPAAPAPAPSLDLSLGMPPMVAAQPFLFLDPRLAVTVAVAAPVPRRPTAAAAGAGASKQ
AAYSCCREDEQSDTGSSSSVVDASPAVGVGFDLNMPPPGEVA*

MAPRNALPAASAVANGMVMEPRFRGVRKRPWGRFAAEIRDPARKARVWLGTFDTAEAAAR
AYDAAALHFRGPKAKTNFPVAFAALPPPPPPKKPAAVTVSPSSSSTVESSSSSSRDSPAT
PPRPASPSQQAPSLDLSLGGTPAMVAAQPFLFLDPRLAVTVAVPAPVPYRPTAVAAGANK
HAAASCREEEQSDTGSSSSVVDASPAVGVGFDLNMPPPAEVA*

Other information
Ka divergence:-0.0797622KaKs divergence:-0.466139
GC content 1 (%):76GC content 2 (%):74GC content divergence:-0.013
Length 1 (bp):669Length 2 (bp):669Length divergence:0
MFE 1 (kcal):-370.7MFE 2 (kcal):-348.4MFE divergence-0.031