Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G069009-GRMZM2G475017
Species:maize
Duplication type:WGD
Function (paralog1):zinc finger CCCH type domain-containing protein ZFN-like 3
Function (paralog2):zinc finger CCCH type domain-containing protein ZFN-like 3

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.47040866198285
Log2 mRNA fold difference:-0.78416850238183
Log2 TE fold difference:0.31820052363027
Sequences
Protein sequence

MEPYAAAKSGGADAGTGTGLEDSMRRLGLGDDGEAGEEKLPERPGEADCAYYLRTGACGY
GERCRYNHPRDRPAPVNGVGKTAVTVEYPERPGQPLCEYYAKNGTCKFGSNCKFDHPREG
GFVPVTLNSGGFPLRLGEKECSYYMKTGHCKFGATCKFHHPELGFLTETPGMYPPVQPPP
ISSSHPYPHLANWQMGRPPVVPGSFLPGSYPPMVLPHTVIPMQGWNPYVPPMNQVTPAGG
QQAVPVGASYGLSHQGPTSAMTYGSHYAQLYSSSGTSSSNIQEYAFPERPGQPECEHYMK
TGTCKYGAACKYHHPQYFSGPKSNCILSPLGLPLRPGSQPCAYYAHHGYCKFGPTCKFDH
PMGTPNYSISTSSLTDVPIAPYPQSFPVTPMPSYLPSSDLRPQYTQVKDSSANPPPSPGT
TYGPVGSISKVYAPHTLIRSPASAAAGMQAS*

MEPYAATKGGESDAGTGLEESMRKLGLGEDDEAGEEKLPERPGEADCTYYLRTGACGYGE
RCRYNHPRDRPAPVNGVGKTTGMEYPERPGQPLCEYYAKNGTCKFGSNCKFDHPRESGFV
PVALNNSGFPLRLGEKECSYYMKTGHCKFGGTCKFHHPELGFLTETPGMYPPVQPSPISS
PHPYPHHSNWQMGRPAVVPGSFLPGPYPPMMLPPTVMPMQGWNPYVSPMNQTTPAGGQQA
VPAGPSYGLSHQEPTSAVTYGSHYAQLYSSSGTSSSNIQEYVFPERPGQPECEHYMKTGT
CKYGAACKYHHPQYFSGPKSNCILSPLGLPLRPGSQRCAYYAHHGFCKFGPTCKFDHPMG
TPNYSLPAPSLTDVPVAPYPHTFSVTPIAPYLLPPDPRPQYTLAKDPSAYPPQAPGTTYG
PVGAISKVYARHTLIRSPTSGAAGMQAS*

Other information
Ka divergence:0.0881678KaKs divergence:0.029041
GC content 1 (%):52GC content 2 (%):53GC content divergence:0.01
Length 1 (bp):1356Length 2 (bp):1347Length divergence:-0.003
MFE 1 (kcal):-463.81MFE 2 (kcal):-457.18MFE divergence-0.007